Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XME0

Protein Details
Accession B7XME0   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
47-69FEFKKKNPPIEKKTPPKNPPQNWHydrophilic
NLS Segment(s)
PositionSequence
39-41PGR
44-63PPHFEFKKKNPPIEKKTPPK
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MKTRPPEEKIDPLVASPFPNQKRNFNSPSPPKGPFGLKPGRVFPPHFEFKKKNPPIEKKTPPKNPPQNWGFRAQGFFFFHKPLKRKVPLKNFSPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.25
4 0.29
5 0.3
6 0.37
7 0.39
8 0.45
9 0.52
10 0.57
11 0.6
12 0.56
13 0.61
14 0.62
15 0.68
16 0.64
17 0.59
18 0.52
19 0.49
20 0.47
21 0.4
22 0.39
23 0.38
24 0.38
25 0.38
26 0.39
27 0.41
28 0.4
29 0.38
30 0.35
31 0.34
32 0.37
33 0.36
34 0.38
35 0.38
36 0.42
37 0.52
38 0.52
39 0.52
40 0.55
41 0.63
42 0.66
43 0.72
44 0.76
45 0.74
46 0.8
47 0.82
48 0.78
49 0.8
50 0.82
51 0.77
52 0.76
53 0.73
54 0.72
55 0.65
56 0.65
57 0.57
58 0.49
59 0.47
60 0.39
61 0.38
62 0.33
63 0.34
64 0.3
65 0.31
66 0.34
67 0.39
68 0.43
69 0.45
70 0.51
71 0.58
72 0.64
73 0.71
74 0.77
75 0.77