Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1R3RAF9

Protein Details
Accession A0A1R3RAF9   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
30-49CWSIIKRQLRHLKSPRVWLAHydrophilic
357-381KDREIWKKLYDDFRRRRRDVCKLLSBasic
NLS Segment(s)
Subcellular Location(s) mito 7plas 7, golg 5, cyto_nucl 3, nucl 2.5, cyto 2.5, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0016740  F:transferase activity  
GO:0048856  P:anatomical structure development  
GO:0043934  P:sporulation  
Amino Acid Sequences MAVKKVPILPYRRGSDSSEADFFDIPDEPCWSIIKRQLRHLKSPRVWLAFFVFVLFVLFLRREKPPPPPLPHIDYDRVDWSLYAYSQYATSSPYLCNALIVFDTLQRLGSRAQRVLFYPENWDVLVDDDRDRDSQLLAIAAEKYNVLLVPIDVQMVKAGAGPNESWDKSISKLLAFGETEFDRVIHIDSDVSVLQNMDELFFLPPSQVAMPRAYWQLPDTKQLSSLLIVLEPSFKEWYALMDSAHAITYGQVESNVSSRVKYDMELMNERYGDSALVLPHRQYGLVTGEFRKDDHRAFLGNEYEEWDPEKVLAEAKLVHFSDWPLPKPWVMWPQELIADMLPKCKVKPGTVHESGCKDREIWKKLYDDFRRRRRDVCKLLSYPAPNWPPREKPKDPLAGLPLTPETPESPVNEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.54
3 0.53
4 0.5
5 0.45
6 0.4
7 0.37
8 0.34
9 0.29
10 0.24
11 0.21
12 0.17
13 0.16
14 0.18
15 0.17
16 0.18
17 0.2
18 0.2
19 0.23
20 0.31
21 0.38
22 0.4
23 0.49
24 0.59
25 0.63
26 0.71
27 0.76
28 0.78
29 0.75
30 0.8
31 0.78
32 0.74
33 0.68
34 0.6
35 0.54
36 0.45
37 0.39
38 0.3
39 0.21
40 0.15
41 0.15
42 0.13
43 0.08
44 0.08
45 0.1
46 0.1
47 0.13
48 0.17
49 0.21
50 0.24
51 0.34
52 0.42
53 0.5
54 0.57
55 0.62
56 0.65
57 0.67
58 0.68
59 0.65
60 0.61
61 0.53
62 0.48
63 0.43
64 0.37
65 0.31
66 0.26
67 0.22
68 0.17
69 0.16
70 0.14
71 0.12
72 0.11
73 0.11
74 0.12
75 0.11
76 0.11
77 0.12
78 0.12
79 0.12
80 0.14
81 0.15
82 0.14
83 0.15
84 0.13
85 0.12
86 0.11
87 0.12
88 0.1
89 0.09
90 0.11
91 0.1
92 0.11
93 0.1
94 0.11
95 0.14
96 0.19
97 0.23
98 0.24
99 0.26
100 0.26
101 0.28
102 0.33
103 0.33
104 0.27
105 0.28
106 0.27
107 0.26
108 0.25
109 0.23
110 0.17
111 0.16
112 0.17
113 0.13
114 0.12
115 0.12
116 0.14
117 0.14
118 0.14
119 0.12
120 0.11
121 0.1
122 0.1
123 0.09
124 0.08
125 0.09
126 0.09
127 0.09
128 0.09
129 0.08
130 0.07
131 0.07
132 0.06
133 0.06
134 0.05
135 0.04
136 0.06
137 0.06
138 0.07
139 0.07
140 0.07
141 0.07
142 0.06
143 0.07
144 0.06
145 0.07
146 0.07
147 0.08
148 0.08
149 0.1
150 0.14
151 0.14
152 0.13
153 0.14
154 0.15
155 0.15
156 0.18
157 0.16
158 0.12
159 0.14
160 0.14
161 0.15
162 0.14
163 0.13
164 0.13
165 0.12
166 0.13
167 0.11
168 0.1
169 0.08
170 0.08
171 0.09
172 0.06
173 0.06
174 0.05
175 0.05
176 0.07
177 0.07
178 0.06
179 0.06
180 0.05
181 0.05
182 0.06
183 0.06
184 0.05
185 0.05
186 0.05
187 0.06
188 0.06
189 0.06
190 0.05
191 0.05
192 0.05
193 0.06
194 0.07
195 0.08
196 0.09
197 0.1
198 0.12
199 0.14
200 0.13
201 0.13
202 0.13
203 0.18
204 0.18
205 0.22
206 0.22
207 0.2
208 0.21
209 0.21
210 0.21
211 0.15
212 0.14
213 0.1
214 0.08
215 0.08
216 0.07
217 0.07
218 0.07
219 0.08
220 0.08
221 0.07
222 0.08
223 0.08
224 0.09
225 0.11
226 0.11
227 0.1
228 0.1
229 0.1
230 0.1
231 0.1
232 0.08
233 0.05
234 0.05
235 0.06
236 0.06
237 0.06
238 0.05
239 0.06
240 0.06
241 0.08
242 0.11
243 0.09
244 0.09
245 0.1
246 0.12
247 0.12
248 0.12
249 0.16
250 0.16
251 0.21
252 0.24
253 0.26
254 0.25
255 0.25
256 0.24
257 0.2
258 0.17
259 0.12
260 0.09
261 0.09
262 0.08
263 0.1
264 0.11
265 0.11
266 0.13
267 0.13
268 0.12
269 0.1
270 0.12
271 0.14
272 0.16
273 0.18
274 0.18
275 0.21
276 0.21
277 0.22
278 0.22
279 0.22
280 0.21
281 0.22
282 0.23
283 0.22
284 0.23
285 0.27
286 0.26
287 0.23
288 0.22
289 0.21
290 0.2
291 0.18
292 0.19
293 0.15
294 0.11
295 0.11
296 0.12
297 0.09
298 0.11
299 0.11
300 0.1
301 0.12
302 0.13
303 0.19
304 0.18
305 0.18
306 0.17
307 0.18
308 0.25
309 0.27
310 0.28
311 0.26
312 0.27
313 0.27
314 0.28
315 0.33
316 0.34
317 0.34
318 0.34
319 0.33
320 0.33
321 0.34
322 0.33
323 0.27
324 0.19
325 0.2
326 0.17
327 0.18
328 0.19
329 0.19
330 0.19
331 0.25
332 0.28
333 0.27
334 0.36
335 0.41
336 0.48
337 0.54
338 0.57
339 0.55
340 0.59
341 0.58
342 0.51
343 0.44
344 0.36
345 0.38
346 0.44
347 0.45
348 0.44
349 0.46
350 0.49
351 0.55
352 0.64
353 0.66
354 0.67
355 0.71
356 0.76
357 0.81
358 0.79
359 0.81
360 0.8
361 0.81
362 0.8
363 0.79
364 0.79
365 0.72
366 0.73
367 0.72
368 0.66
369 0.58
370 0.56
371 0.55
372 0.49
373 0.52
374 0.55
375 0.58
376 0.64
377 0.71
378 0.67
379 0.67
380 0.72
381 0.76
382 0.7
383 0.67
384 0.63
385 0.57
386 0.52
387 0.48
388 0.4
389 0.31
390 0.29
391 0.24
392 0.2
393 0.19
394 0.22