Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XMW5

Protein Details
Accession B7XMW5   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
25-50CEVVGKKKRIYKLRQKIKKAYHRELLHydrophilic
NLS Segment(s)
PositionSequence
30-43KKKRIYKLRQKIKK
Subcellular Location(s) nucl 9.5cyto_nucl 9.5, cyto 8.5, mito 4, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MDAALICPNGHIIQNTIVEKEKMECEVVGKKKRIYKLRQKIKKAYHRELLVEGEELLLSLYKLFVEAKSYFEFTTDRFFKFMCGTWRYKDGHQNVVKDSIEIIKDVLVTRIIRCMQIIVCIWIIKRRYWEYAMLIIHLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.25
5 0.24
6 0.24
7 0.24
8 0.22
9 0.18
10 0.18
11 0.16
12 0.17
13 0.25
14 0.33
15 0.39
16 0.41
17 0.44
18 0.49
19 0.57
20 0.63
21 0.65
22 0.68
23 0.71
24 0.77
25 0.82
26 0.85
27 0.86
28 0.87
29 0.87
30 0.85
31 0.82
32 0.78
33 0.7
34 0.63
35 0.56
36 0.47
37 0.38
38 0.28
39 0.21
40 0.13
41 0.11
42 0.09
43 0.07
44 0.05
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04
51 0.04
52 0.08
53 0.09
54 0.11
55 0.13
56 0.14
57 0.13
58 0.14
59 0.14
60 0.11
61 0.18
62 0.18
63 0.17
64 0.17
65 0.17
66 0.17
67 0.19
68 0.21
69 0.2
70 0.23
71 0.25
72 0.27
73 0.32
74 0.33
75 0.35
76 0.4
77 0.38
78 0.43
79 0.44
80 0.45
81 0.41
82 0.44
83 0.4
84 0.32
85 0.29
86 0.22
87 0.18
88 0.16
89 0.14
90 0.09
91 0.1
92 0.11
93 0.11
94 0.11
95 0.12
96 0.12
97 0.17
98 0.18
99 0.17
100 0.17
101 0.18
102 0.16
103 0.19
104 0.2
105 0.16
106 0.17
107 0.18
108 0.18
109 0.22
110 0.24
111 0.23
112 0.3
113 0.32
114 0.36
115 0.37
116 0.41
117 0.39
118 0.44
119 0.42