Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XLD2

Protein Details
Accession B7XLD2    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MFFIKGPPRGKKKNFSHHLPRGVKBasic
NLS Segment(s)
PositionSequence
9-13RGKKK
Subcellular Location(s) mito 18.5, cyto_mito 11.333, nucl 5.5, cyto_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MFFIKGPPRGKKKNFSHHLPRGVKFFFFFWENKPPRVWGVFRDVFFLKKEGWFYNSLQKKKGGVFGKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.83
4 0.82
5 0.85
6 0.8
7 0.72
8 0.66
9 0.6
10 0.51
11 0.41
12 0.33
13 0.25
14 0.21
15 0.2
16 0.18
17 0.28
18 0.29
19 0.3
20 0.3
21 0.28
22 0.28
23 0.3
24 0.27
25 0.19
26 0.25
27 0.28
28 0.27
29 0.3
30 0.28
31 0.27
32 0.27
33 0.26
34 0.18
35 0.17
36 0.2
37 0.18
38 0.21
39 0.22
40 0.24
41 0.32
42 0.4
43 0.41
44 0.41
45 0.42
46 0.43
47 0.44
48 0.5