Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XR29

Protein Details
Accession B7XR29   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
117-136VRVHRRQKTESERKRRSAGTBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, pero 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025973  Cys_rich_VLP_dom  
Pfam View protein in Pfam  
PF14194  Cys_rich_VLP  
Amino Acid Sequences MRDNPYKDLPPLERRPDGSLYRMTPAQRKQAASLIRRECCCCEDGNCIVLDDGDTCTCPQTVSFSVCCKWFRWAVLPLDGTLEAEIFRDKDLKCCAVCGGVFVPKSNRAKYCPGCAVRVHRRQKTESERKRRSAGTVRSEKSLDLSGPQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.57
4 0.53
5 0.47
6 0.45
7 0.39
8 0.38
9 0.39
10 0.37
11 0.38
12 0.4
13 0.46
14 0.45
15 0.44
16 0.43
17 0.46
18 0.51
19 0.47
20 0.51
21 0.49
22 0.49
23 0.5
24 0.5
25 0.46
26 0.4
27 0.38
28 0.3
29 0.25
30 0.25
31 0.25
32 0.23
33 0.21
34 0.19
35 0.17
36 0.16
37 0.13
38 0.09
39 0.08
40 0.07
41 0.07
42 0.07
43 0.08
44 0.08
45 0.07
46 0.07
47 0.1
48 0.11
49 0.14
50 0.15
51 0.17
52 0.18
53 0.21
54 0.22
55 0.19
56 0.2
57 0.19
58 0.19
59 0.21
60 0.24
61 0.23
62 0.25
63 0.24
64 0.21
65 0.21
66 0.19
67 0.15
68 0.1
69 0.08
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.1
76 0.1
77 0.14
78 0.17
79 0.2
80 0.2
81 0.2
82 0.2
83 0.18
84 0.18
85 0.15
86 0.14
87 0.15
88 0.15
89 0.16
90 0.18
91 0.23
92 0.28
93 0.31
94 0.32
95 0.32
96 0.41
97 0.44
98 0.48
99 0.5
100 0.48
101 0.47
102 0.49
103 0.54
104 0.55
105 0.61
106 0.64
107 0.62
108 0.65
109 0.66
110 0.71
111 0.73
112 0.74
113 0.75
114 0.76
115 0.79
116 0.79
117 0.82
118 0.74
119 0.72
120 0.71
121 0.69
122 0.68
123 0.69
124 0.65
125 0.64
126 0.62
127 0.53
128 0.46
129 0.4
130 0.3