Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XR46

Protein Details
Accession B7XR46   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
16-37FMQETKRSRRFKKTNGERFNDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 14, cyto 10.5
Family & Domain DBs
Gene Ontology GO:0000502  C:proteasome complex  
Amino Acid Sequences MADTGIQSGYRELFVFMQETKRSRRFKKTNGERFNDVVKEFVGEVKNNTRINYRDILMKGRYNLIDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.18
5 0.21
6 0.24
7 0.29
8 0.37
9 0.45
10 0.49
11 0.59
12 0.62
13 0.67
14 0.75
15 0.79
16 0.82
17 0.82
18 0.8
19 0.72
20 0.65
21 0.59
22 0.5
23 0.39
24 0.28
25 0.2
26 0.16
27 0.12
28 0.14
29 0.12
30 0.11
31 0.14
32 0.19
33 0.26
34 0.26
35 0.28
36 0.29
37 0.29
38 0.33
39 0.34
40 0.3
41 0.29
42 0.3
43 0.35
44 0.35
45 0.37
46 0.34
47 0.36
48 0.37