Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1R3RSM9

Protein Details
Accession A0A1R3RSM9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-31DPKLVTDKRSRRFLPKKRYRKVLRNNIDGIHydrophilic
NLS Segment(s)
PositionSequence
9-25KRSRRFLPKKRYRKVLR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MDPKLVTDKRSRRFLPKKRYRKVLRNNIDGITRPTIRRLARRGGVIRISAGIYAEVRVALKDRLTEILRQVVHIMDSSTTPRRERKVVTTRDMGHTLYGFNTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.82
4 0.85
5 0.85
6 0.91
7 0.9
8 0.9
9 0.9
10 0.9
11 0.88
12 0.84
13 0.78
14 0.69
15 0.62
16 0.53
17 0.45
18 0.39
19 0.33
20 0.26
21 0.25
22 0.3
23 0.31
24 0.36
25 0.36
26 0.38
27 0.39
28 0.44
29 0.44
30 0.42
31 0.4
32 0.34
33 0.29
34 0.23
35 0.2
36 0.14
37 0.11
38 0.08
39 0.06
40 0.05
41 0.05
42 0.05
43 0.04
44 0.05
45 0.06
46 0.06
47 0.07
48 0.07
49 0.08
50 0.12
51 0.13
52 0.15
53 0.15
54 0.21
55 0.2
56 0.2
57 0.2
58 0.16
59 0.15
60 0.14
61 0.13
62 0.07
63 0.09
64 0.13
65 0.18
66 0.21
67 0.24
68 0.3
69 0.34
70 0.39
71 0.43
72 0.49
73 0.53
74 0.58
75 0.61
76 0.63
77 0.62
78 0.62
79 0.6
80 0.5
81 0.42
82 0.35
83 0.29