Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XN74

Protein Details
Accession B7XN74    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-91MWGKPFKKPPRKKTPGFFPPSQQKFSPPFPFEKKKKKNFQNSLTPPQRPPLFLKKKAQKKNIFPPPKKKNHPPYKKKISSPPQKNHPINNIHydrophilic
NLS Segment(s)
PositionSequence
4-81KPFKKPPRKKTPGFFPPSQQKFSPPFPFEKKKKKNFQNSLTPPQRPPLFLKKKAQKKNIFPPPKKKNHPPYKKKISSP
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MWGKPFKKPPRKKTPGFFPPSQQKFSPPFPFEKKKKKNFQNSLTPPQRPPLFLKKKAQKKNIFPPPKKKNHPPYKKKISSPPQKNHPINNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.85
4 0.78
5 0.75
6 0.76
7 0.73
8 0.67
9 0.57
10 0.52
11 0.5
12 0.54
13 0.53
14 0.45
15 0.46
16 0.5
17 0.6
18 0.63
19 0.69
20 0.72
21 0.74
22 0.81
23 0.84
24 0.87
25 0.86
26 0.84
27 0.84
28 0.81
29 0.82
30 0.77
31 0.7
32 0.59
33 0.55
34 0.48
35 0.39
36 0.37
37 0.38
38 0.41
39 0.46
40 0.55
41 0.59
42 0.68
43 0.75
44 0.8
45 0.78
46 0.78
47 0.82
48 0.83
49 0.85
50 0.83
51 0.85
52 0.85
53 0.87
54 0.86
55 0.86
56 0.86
57 0.87
58 0.9
59 0.9
60 0.9
61 0.91
62 0.91
63 0.88
64 0.87
65 0.87
66 0.87
67 0.87
68 0.86
69 0.85
70 0.87
71 0.86