Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1R3R9F8

Protein Details
Accession A0A1R3R9F8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
105-125SNIWVIRKQTRRKRAGQEDEVHydrophilic
NLS Segment(s)
PositionSequence
315-323KMRKKKAKL
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007018  Mediator_Med6  
IPR016612  Mediator_Med6_fun  
IPR038566  Mediator_Med6_sf  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF04934  Med6  
Amino Acid Sequences MAGTPDASMEEILWRSPPHVQMMGGYLHSNNILFYFAESPFFDPTSNNASLAIQANYNEAFRHFVETREAFEGRLKTMQGLEFVVSYDPIQAAAQPDGRFAHDPSNIWVIRKQTRRKRAGQEDEVVVLSTYFIVGDCIYMAPSVASVVGNRILSAVTSLTSLLKTASALPSFTPSHGHTYLPPAPKHADASQPGTQSQQSKENTPLPEDAAGKAPLVGSQVVSAGSSLQDTRTLAESFSLLSRYGDEFMDEHPLVGEPGSFILSRVNDTDRTLTAKQAANVGTTAGKVGTPQVRVDTPGRASEKGATPSGTDESKMRKKKAKLGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.2
4 0.23
5 0.24
6 0.26
7 0.25
8 0.25
9 0.27
10 0.27
11 0.23
12 0.21
13 0.16
14 0.15
15 0.15
16 0.14
17 0.11
18 0.09
19 0.1
20 0.09
21 0.1
22 0.13
23 0.12
24 0.15
25 0.16
26 0.17
27 0.18
28 0.19
29 0.17
30 0.15
31 0.19
32 0.23
33 0.23
34 0.21
35 0.19
36 0.19
37 0.21
38 0.23
39 0.2
40 0.14
41 0.13
42 0.15
43 0.15
44 0.15
45 0.13
46 0.11
47 0.14
48 0.13
49 0.2
50 0.18
51 0.19
52 0.26
53 0.26
54 0.29
55 0.3
56 0.3
57 0.24
58 0.28
59 0.28
60 0.23
61 0.25
62 0.22
63 0.18
64 0.21
65 0.21
66 0.17
67 0.16
68 0.15
69 0.12
70 0.12
71 0.11
72 0.09
73 0.08
74 0.08
75 0.07
76 0.07
77 0.07
78 0.07
79 0.09
80 0.11
81 0.15
82 0.14
83 0.16
84 0.16
85 0.18
86 0.19
87 0.18
88 0.22
89 0.2
90 0.21
91 0.22
92 0.29
93 0.27
94 0.26
95 0.28
96 0.27
97 0.33
98 0.41
99 0.48
100 0.51
101 0.61
102 0.67
103 0.73
104 0.78
105 0.81
106 0.81
107 0.77
108 0.71
109 0.61
110 0.55
111 0.47
112 0.36
113 0.25
114 0.16
115 0.1
116 0.06
117 0.04
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.03
129 0.03
130 0.03
131 0.03
132 0.04
133 0.03
134 0.05
135 0.07
136 0.07
137 0.07
138 0.07
139 0.06
140 0.06
141 0.07
142 0.06
143 0.04
144 0.04
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.06
153 0.08
154 0.08
155 0.08
156 0.08
157 0.12
158 0.12
159 0.12
160 0.14
161 0.13
162 0.18
163 0.19
164 0.19
165 0.16
166 0.23
167 0.28
168 0.31
169 0.3
170 0.27
171 0.28
172 0.28
173 0.31
174 0.26
175 0.25
176 0.22
177 0.28
178 0.29
179 0.28
180 0.27
181 0.26
182 0.27
183 0.25
184 0.25
185 0.26
186 0.24
187 0.26
188 0.3
189 0.34
190 0.33
191 0.32
192 0.3
193 0.24
194 0.26
195 0.24
196 0.2
197 0.18
198 0.17
199 0.15
200 0.14
201 0.13
202 0.1
203 0.1
204 0.1
205 0.07
206 0.06
207 0.07
208 0.07
209 0.07
210 0.06
211 0.05
212 0.05
213 0.06
214 0.06
215 0.06
216 0.07
217 0.08
218 0.09
219 0.12
220 0.12
221 0.11
222 0.12
223 0.11
224 0.11
225 0.12
226 0.11
227 0.09
228 0.09
229 0.1
230 0.11
231 0.12
232 0.12
233 0.12
234 0.11
235 0.12
236 0.18
237 0.16
238 0.15
239 0.14
240 0.14
241 0.13
242 0.13
243 0.12
244 0.05
245 0.06
246 0.07
247 0.07
248 0.07
249 0.11
250 0.11
251 0.13
252 0.15
253 0.17
254 0.17
255 0.2
256 0.22
257 0.2
258 0.26
259 0.25
260 0.25
261 0.28
262 0.29
263 0.28
264 0.31
265 0.3
266 0.25
267 0.24
268 0.23
269 0.18
270 0.15
271 0.14
272 0.09
273 0.09
274 0.08
275 0.14
276 0.17
277 0.19
278 0.2
279 0.24
280 0.25
281 0.29
282 0.31
283 0.31
284 0.29
285 0.34
286 0.36
287 0.34
288 0.34
289 0.36
290 0.4
291 0.39
292 0.38
293 0.32
294 0.29
295 0.31
296 0.33
297 0.28
298 0.23
299 0.24
300 0.31
301 0.4
302 0.48
303 0.53
304 0.58
305 0.65