Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1R3S2I8

Protein Details
Accession A0A1R3S2I8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
31-56GDTLVRRDWKRNKRTSKQDTTDTRSGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 8, extr 3
Family & Domain DBs
Amino Acid Sequences MSQTLSRFCSYPQEREGGTCPIGVYLGGYVGDTLVRRDWKRNKRTSKQDTTDTRSGPPGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.39
4 0.32
5 0.28
6 0.22
7 0.19
8 0.15
9 0.15
10 0.12
11 0.09
12 0.05
13 0.04
14 0.04
15 0.04
16 0.03
17 0.03
18 0.04
19 0.04
20 0.05
21 0.07
22 0.13
23 0.14
24 0.23
25 0.34
26 0.44
27 0.54
28 0.63
29 0.72
30 0.77
31 0.87
32 0.88
33 0.89
34 0.85
35 0.84
36 0.83
37 0.81
38 0.77
39 0.68
40 0.61