Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1R3RB83

Protein Details
Accession A0A1R3RB83   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
140-163APPSGKKLGKWPRIRYNLDKWSKKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, pero 7, mito_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008914  PEBP  
IPR036610  PEBP-like_sf  
IPR035810  PEBP_euk  
Pfam View protein in Pfam  
PF01161  PBP  
CDD cd00866  PEBP_euk  
Amino Acid Sequences MPTRKNVEKAITLLERDENKILGLTFGTRYVHPGQYVAKSDAANPPQLSFQRLKACGTYMVVCLDLDAPFASFNLLSPILHWIQPGLLPIRTESGSYVLRVAAPFVADYMGPHPPPRAAPHRYLFILFEQPPGFEVESHAPPSGKKLGKWPRIRYNLDKWSKKIGLGPVVGANYIASN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.33
4 0.32
5 0.25
6 0.22
7 0.22
8 0.2
9 0.15
10 0.13
11 0.12
12 0.11
13 0.13
14 0.14
15 0.13
16 0.18
17 0.21
18 0.23
19 0.21
20 0.22
21 0.23
22 0.26
23 0.3
24 0.28
25 0.27
26 0.24
27 0.26
28 0.31
29 0.3
30 0.3
31 0.26
32 0.25
33 0.26
34 0.27
35 0.29
36 0.24
37 0.27
38 0.31
39 0.32
40 0.32
41 0.28
42 0.29
43 0.26
44 0.26
45 0.22
46 0.15
47 0.14
48 0.13
49 0.12
50 0.11
51 0.1
52 0.08
53 0.07
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.04
60 0.05
61 0.07
62 0.07
63 0.07
64 0.07
65 0.1
66 0.11
67 0.11
68 0.11
69 0.08
70 0.08
71 0.09
72 0.1
73 0.08
74 0.08
75 0.08
76 0.09
77 0.1
78 0.1
79 0.1
80 0.09
81 0.11
82 0.11
83 0.11
84 0.11
85 0.09
86 0.09
87 0.09
88 0.09
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.04
95 0.05
96 0.07
97 0.09
98 0.09
99 0.1
100 0.11
101 0.12
102 0.14
103 0.19
104 0.25
105 0.26
106 0.32
107 0.35
108 0.38
109 0.38
110 0.37
111 0.33
112 0.27
113 0.3
114 0.24
115 0.24
116 0.21
117 0.2
118 0.2
119 0.21
120 0.19
121 0.12
122 0.15
123 0.16
124 0.18
125 0.2
126 0.21
127 0.19
128 0.18
129 0.23
130 0.29
131 0.27
132 0.26
133 0.35
134 0.44
135 0.54
136 0.63
137 0.68
138 0.69
139 0.76
140 0.82
141 0.79
142 0.79
143 0.8
144 0.8
145 0.78
146 0.71
147 0.72
148 0.66
149 0.6
150 0.56
151 0.52
152 0.48
153 0.42
154 0.41
155 0.35
156 0.33
157 0.31
158 0.26