Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1R3RZR3

Protein Details
Accession A0A1R3RZR3   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
66-94RSRSPSAPESARRRNRKSNPKLPAGKSKAHydrophilic
NLS Segment(s)
PositionSequence
61-94KRSRARSRSPSAPESARRRNRKSNPKLPAGKSKA
Subcellular Location(s) plas 15, nucl 5, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037997  Dgk1-like  
Gene Ontology GO:0016020  C:membrane  
GO:0004143  F:diacylglycerol kinase activity  
Amino Acid Sequences MPSEPDSIPETPRITSPSPTPSERRSGLGDYSGPTTRSAARRQRLGEVTEEAHDTPNSDSKRSRARSRSPSAPESARRRNRKSNPKLPAGKSKAPTNGHAASNGYLSPLAKPGSGWPDISRSPSPLGLIPLHSRYRTFIHRHEIPRKLLHVSIGFLTLNLYSRGIQPLQITPWLFGALVPIAAIDVIRHRPEFQRVNEMYIRCVGALMRETEVSGYNGVIWYLVGTYTVLRFLPKDVGVMSVLLLSWCDTAASTFGRLYGRHTFQLRKGKSFAGTLGAWFVGVLTAAAFWGYFVPSIGTFPNDPEGSFMFTGRLNLLPDSVRNLIGWTAESSSSIISGPLALGVMSVVSGLVAAGSEFVDILGMDDNLTIPILSGIGLWGFLKVFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.34
4 0.37
5 0.41
6 0.45
7 0.49
8 0.48
9 0.53
10 0.52
11 0.49
12 0.46
13 0.44
14 0.41
15 0.38
16 0.36
17 0.29
18 0.32
19 0.31
20 0.27
21 0.24
22 0.24
23 0.27
24 0.31
25 0.39
26 0.45
27 0.49
28 0.56
29 0.58
30 0.64
31 0.62
32 0.58
33 0.52
34 0.46
35 0.41
36 0.35
37 0.34
38 0.27
39 0.24
40 0.22
41 0.19
42 0.17
43 0.23
44 0.23
45 0.25
46 0.26
47 0.3
48 0.41
49 0.46
50 0.54
51 0.56
52 0.64
53 0.71
54 0.76
55 0.8
56 0.77
57 0.74
58 0.7
59 0.68
60 0.67
61 0.66
62 0.69
63 0.69
64 0.72
65 0.75
66 0.8
67 0.84
68 0.86
69 0.88
70 0.87
71 0.85
72 0.86
73 0.87
74 0.82
75 0.82
76 0.79
77 0.75
78 0.69
79 0.67
80 0.65
81 0.58
82 0.55
83 0.51
84 0.48
85 0.41
86 0.38
87 0.34
88 0.26
89 0.24
90 0.21
91 0.15
92 0.11
93 0.11
94 0.1
95 0.12
96 0.11
97 0.1
98 0.11
99 0.14
100 0.18
101 0.19
102 0.2
103 0.18
104 0.22
105 0.23
106 0.28
107 0.25
108 0.23
109 0.23
110 0.22
111 0.22
112 0.19
113 0.21
114 0.17
115 0.18
116 0.19
117 0.22
118 0.24
119 0.23
120 0.22
121 0.22
122 0.25
123 0.3
124 0.32
125 0.33
126 0.38
127 0.45
128 0.53
129 0.59
130 0.61
131 0.58
132 0.56
133 0.53
134 0.47
135 0.4
136 0.35
137 0.27
138 0.22
139 0.18
140 0.16
141 0.14
142 0.11
143 0.11
144 0.09
145 0.09
146 0.08
147 0.08
148 0.07
149 0.09
150 0.11
151 0.11
152 0.12
153 0.12
154 0.13
155 0.14
156 0.16
157 0.16
158 0.14
159 0.14
160 0.13
161 0.11
162 0.09
163 0.09
164 0.06
165 0.06
166 0.05
167 0.04
168 0.04
169 0.04
170 0.03
171 0.03
172 0.05
173 0.07
174 0.08
175 0.09
176 0.11
177 0.13
178 0.19
179 0.25
180 0.25
181 0.33
182 0.32
183 0.36
184 0.38
185 0.37
186 0.31
187 0.26
188 0.25
189 0.15
190 0.14
191 0.1
192 0.08
193 0.09
194 0.09
195 0.08
196 0.08
197 0.08
198 0.09
199 0.1
200 0.09
201 0.08
202 0.06
203 0.06
204 0.06
205 0.06
206 0.05
207 0.04
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.04
214 0.04
215 0.05
216 0.05
217 0.06
218 0.06
219 0.08
220 0.1
221 0.1
222 0.11
223 0.1
224 0.11
225 0.11
226 0.11
227 0.1
228 0.07
229 0.06
230 0.06
231 0.05
232 0.05
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.06
239 0.07
240 0.07
241 0.07
242 0.09
243 0.11
244 0.11
245 0.16
246 0.22
247 0.24
248 0.27
249 0.31
250 0.33
251 0.4
252 0.5
253 0.48
254 0.45
255 0.45
256 0.43
257 0.41
258 0.38
259 0.31
260 0.25
261 0.23
262 0.18
263 0.17
264 0.14
265 0.12
266 0.1
267 0.09
268 0.05
269 0.04
270 0.04
271 0.03
272 0.03
273 0.03
274 0.03
275 0.03
276 0.03
277 0.04
278 0.04
279 0.04
280 0.05
281 0.06
282 0.06
283 0.08
284 0.09
285 0.1
286 0.1
287 0.11
288 0.17
289 0.16
290 0.15
291 0.17
292 0.17
293 0.19
294 0.19
295 0.18
296 0.14
297 0.14
298 0.16
299 0.15
300 0.15
301 0.13
302 0.13
303 0.14
304 0.14
305 0.15
306 0.19
307 0.19
308 0.17
309 0.16
310 0.17
311 0.16
312 0.15
313 0.15
314 0.12
315 0.12
316 0.12
317 0.13
318 0.12
319 0.12
320 0.11
321 0.1
322 0.09
323 0.07
324 0.07
325 0.06
326 0.06
327 0.06
328 0.05
329 0.04
330 0.04
331 0.04
332 0.03
333 0.03
334 0.03
335 0.03
336 0.03
337 0.02
338 0.02
339 0.02
340 0.03
341 0.03
342 0.04
343 0.04
344 0.04
345 0.04
346 0.04
347 0.04
348 0.05
349 0.06
350 0.06
351 0.06
352 0.07
353 0.07
354 0.07
355 0.08
356 0.06
357 0.05
358 0.06
359 0.06
360 0.05
361 0.05
362 0.05
363 0.05
364 0.06
365 0.06
366 0.07