Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1R3RIF3

Protein Details
Accession A0A1R3RIF3   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-33GGRLRRHSNIHARNKKQPFRKPRSTTEVPHydrophilic
NLS Segment(s)
PositionSequence
15-26HARNKKQPFRKP
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MNWTGGRLRRHSNIHARNKKQPFRKPRSTTEVPLSTRFRAPSPLKVNRIRASDPGDQSPQNPDQQDQILSHLLRKPKYRTSYTRALAGSSALG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.77
4 0.8
5 0.84
6 0.84
7 0.82
8 0.82
9 0.82
10 0.81
11 0.86
12 0.83
13 0.8
14 0.81
15 0.77
16 0.71
17 0.68
18 0.65
19 0.57
20 0.56
21 0.51
22 0.44
23 0.41
24 0.37
25 0.3
26 0.31
27 0.31
28 0.34
29 0.39
30 0.44
31 0.48
32 0.52
33 0.57
34 0.53
35 0.54
36 0.47
37 0.42
38 0.41
39 0.4
40 0.37
41 0.34
42 0.32
43 0.29
44 0.28
45 0.3
46 0.27
47 0.25
48 0.24
49 0.22
50 0.22
51 0.23
52 0.24
53 0.19
54 0.2
55 0.2
56 0.2
57 0.23
58 0.24
59 0.27
60 0.3
61 0.36
62 0.4
63 0.45
64 0.52
65 0.57
66 0.62
67 0.64
68 0.69
69 0.65
70 0.66
71 0.57
72 0.51
73 0.43