Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1R3R672

Protein Details
Accession A0A1R3R672    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
197-217QSSSYRERERERERRRGLFEGBasic
NLS Segment(s)
PositionSequence
186-196RVGRGAKGRGL
201-212YRERERERERRR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MFNPNIPIPGRREHHPIVIADDDSDSDDIIPEEEEEGEDDDSDENLDHDTDSDEMELDYSLHSRSQAGIMGYETLPQSRRRFLSRLLAPEDPESAASIRADRFTVQHAHASTSSGGFSASSAAMIVPRRVVDVYETDDAGWRRPERGGRGGGGGAPGSAMQSSPGSVGSGSVSSAKMKGRMGTPDRVGRGAKGRGLQSSSYRERERERERRRGLFEGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.45
4 0.41
5 0.4
6 0.36
7 0.28
8 0.25
9 0.2
10 0.17
11 0.16
12 0.11
13 0.08
14 0.08
15 0.08
16 0.08
17 0.08
18 0.06
19 0.07
20 0.07
21 0.07
22 0.08
23 0.09
24 0.09
25 0.08
26 0.09
27 0.08
28 0.08
29 0.08
30 0.07
31 0.06
32 0.06
33 0.07
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.05
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.08
52 0.09
53 0.11
54 0.1
55 0.1
56 0.1
57 0.12
58 0.11
59 0.12
60 0.11
61 0.1
62 0.12
63 0.18
64 0.2
65 0.23
66 0.26
67 0.29
68 0.31
69 0.33
70 0.41
71 0.4
72 0.42
73 0.42
74 0.4
75 0.37
76 0.35
77 0.32
78 0.23
79 0.18
80 0.14
81 0.09
82 0.09
83 0.08
84 0.08
85 0.08
86 0.08
87 0.09
88 0.08
89 0.09
90 0.1
91 0.13
92 0.13
93 0.16
94 0.16
95 0.17
96 0.16
97 0.17
98 0.15
99 0.12
100 0.11
101 0.08
102 0.07
103 0.06
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.06
111 0.07
112 0.07
113 0.07
114 0.07
115 0.08
116 0.08
117 0.08
118 0.08
119 0.09
120 0.13
121 0.13
122 0.14
123 0.13
124 0.16
125 0.16
126 0.17
127 0.19
128 0.16
129 0.16
130 0.19
131 0.24
132 0.26
133 0.31
134 0.31
135 0.28
136 0.29
137 0.28
138 0.25
139 0.22
140 0.16
141 0.1
142 0.08
143 0.07
144 0.05
145 0.05
146 0.04
147 0.05
148 0.05
149 0.06
150 0.06
151 0.07
152 0.07
153 0.06
154 0.07
155 0.07
156 0.07
157 0.07
158 0.08
159 0.09
160 0.09
161 0.12
162 0.14
163 0.16
164 0.18
165 0.2
166 0.22
167 0.3
168 0.34
169 0.38
170 0.42
171 0.46
172 0.46
173 0.47
174 0.45
175 0.39
176 0.42
177 0.39
178 0.37
179 0.36
180 0.36
181 0.37
182 0.39
183 0.39
184 0.37
185 0.42
186 0.45
187 0.47
188 0.49
189 0.49
190 0.54
191 0.6
192 0.65
193 0.67
194 0.7
195 0.74
196 0.79
197 0.83
198 0.82