Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B7XIV8

Protein Details
Accession B7XIV8    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
197-220DWDRFLPKIKKGKEIKKPKIKTSKBasic
NLS Segment(s)
PositionSequence
203-220PKIKKGKEIKKPKIKTSK
Subcellular Location(s) nucl 14, cyto_nucl 13.5, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR041174  KH_8  
IPR036612  KH_dom_type_1_sf  
IPR024166  rRNA_assembly_KRR1  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF17903  KH_8  
Amino Acid Sequences MVDSFLKFDESVFKHEFVEMTEYSVLFAKSRSNYIKSIEKYLQKAVEAKKLTFEINWNTNTMFVRTNKMTRDPYIIIKAQELLELISKGVLLENCINLLEDGVFSEIIYINVLTRNPTVYENRRNRLSNPKVLKALEILSKTKITVGTKTVCVVGDHDGIDVVRNVVLKAFKNIHPAYEIKALMIKHKLSKDNIEGDWDRFLPKIKKGKEIKKPKIKTSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.3
4 0.23
5 0.25
6 0.19
7 0.19
8 0.19
9 0.18
10 0.17
11 0.19
12 0.17
13 0.12
14 0.13
15 0.16
16 0.17
17 0.24
18 0.28
19 0.3
20 0.32
21 0.37
22 0.45
23 0.42
24 0.47
25 0.47
26 0.48
27 0.47
28 0.5
29 0.47
30 0.4
31 0.45
32 0.41
33 0.43
34 0.4
35 0.37
36 0.35
37 0.34
38 0.33
39 0.27
40 0.28
41 0.26
42 0.28
43 0.29
44 0.27
45 0.25
46 0.27
47 0.26
48 0.23
49 0.22
50 0.18
51 0.23
52 0.25
53 0.28
54 0.29
55 0.34
56 0.36
57 0.33
58 0.37
59 0.34
60 0.34
61 0.35
62 0.35
63 0.29
64 0.26
65 0.26
66 0.2
67 0.18
68 0.15
69 0.1
70 0.09
71 0.09
72 0.08
73 0.06
74 0.06
75 0.06
76 0.07
77 0.06
78 0.07
79 0.08
80 0.08
81 0.08
82 0.08
83 0.09
84 0.07
85 0.07
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.04
97 0.04
98 0.05
99 0.06
100 0.06
101 0.06
102 0.07
103 0.08
104 0.11
105 0.16
106 0.22
107 0.32
108 0.38
109 0.42
110 0.46
111 0.47
112 0.48
113 0.54
114 0.53
115 0.52
116 0.5
117 0.5
118 0.48
119 0.47
120 0.44
121 0.34
122 0.31
123 0.26
124 0.23
125 0.2
126 0.19
127 0.19
128 0.18
129 0.18
130 0.2
131 0.17
132 0.17
133 0.2
134 0.21
135 0.21
136 0.22
137 0.22
138 0.19
139 0.17
140 0.16
141 0.15
142 0.14
143 0.13
144 0.13
145 0.12
146 0.11
147 0.12
148 0.1
149 0.07
150 0.07
151 0.07
152 0.07
153 0.09
154 0.12
155 0.12
156 0.17
157 0.21
158 0.23
159 0.31
160 0.31
161 0.3
162 0.31
163 0.31
164 0.3
165 0.32
166 0.3
167 0.21
168 0.25
169 0.24
170 0.26
171 0.3
172 0.29
173 0.29
174 0.35
175 0.4
176 0.41
177 0.47
178 0.48
179 0.49
180 0.46
181 0.47
182 0.44
183 0.4
184 0.4
185 0.33
186 0.29
187 0.24
188 0.31
189 0.29
190 0.35
191 0.43
192 0.43
193 0.53
194 0.62
195 0.71
196 0.74
197 0.81
198 0.83
199 0.84
200 0.88