Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1R3RGY0

Protein Details
Accession A0A1R3RGY0   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
138-176EQDQPDDKIKRKKKKSKDSQEKKDKKRKHVEVHEPVRFEBasic
NLS Segment(s)
PositionSequence
145-166KIKRKKKKSKDSQEKKDKKRKH
210-225PMGRHVFRGRHIAQKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.833, mito_nucl 12.666, mito 3.5
Family & Domain DBs
Amino Acid Sequences MFTAASASHIKVVLKDDTLGLGARPKRDPLDEPTGLDAFKGLLGRLNGKSDADLQIEQQKRDNAKLARYAASKWQTVTFISGGLLAQEKIEALATEELQTNSKDKQEDRTPVSEPMDGKGRMSTVGSPADGSQDYDKEQDQPDDKIKRKKKKSKDSQEKKDKKRKHVEVHEPVRFEDKNMRSSERADTSSTNGHKEPLPAAIVLSKERRPMGRHVFRGRHIAQKKKALLDEKSLNEVSAEYIDIHVLFTEADM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.19
4 0.18
5 0.19
6 0.17
7 0.13
8 0.18
9 0.2
10 0.23
11 0.25
12 0.28
13 0.3
14 0.34
15 0.38
16 0.38
17 0.44
18 0.42
19 0.41
20 0.41
21 0.39
22 0.34
23 0.3
24 0.22
25 0.13
26 0.13
27 0.11
28 0.08
29 0.1
30 0.12
31 0.17
32 0.19
33 0.21
34 0.21
35 0.21
36 0.22
37 0.21
38 0.23
39 0.21
40 0.19
41 0.18
42 0.26
43 0.29
44 0.29
45 0.31
46 0.33
47 0.33
48 0.35
49 0.41
50 0.35
51 0.36
52 0.42
53 0.41
54 0.4
55 0.39
56 0.38
57 0.38
58 0.39
59 0.36
60 0.3
61 0.29
62 0.26
63 0.25
64 0.25
65 0.17
66 0.13
67 0.12
68 0.11
69 0.09
70 0.08
71 0.09
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.04
79 0.05
80 0.06
81 0.07
82 0.08
83 0.09
84 0.1
85 0.11
86 0.12
87 0.12
88 0.12
89 0.14
90 0.16
91 0.15
92 0.22
93 0.27
94 0.33
95 0.35
96 0.36
97 0.36
98 0.37
99 0.38
100 0.33
101 0.27
102 0.22
103 0.24
104 0.21
105 0.19
106 0.17
107 0.15
108 0.13
109 0.13
110 0.12
111 0.09
112 0.1
113 0.09
114 0.09
115 0.09
116 0.1
117 0.1
118 0.1
119 0.08
120 0.08
121 0.09
122 0.1
123 0.11
124 0.12
125 0.12
126 0.15
127 0.15
128 0.18
129 0.24
130 0.31
131 0.37
132 0.44
133 0.52
134 0.6
135 0.69
136 0.76
137 0.8
138 0.84
139 0.89
140 0.9
141 0.93
142 0.94
143 0.94
144 0.95
145 0.95
146 0.94
147 0.93
148 0.9
149 0.89
150 0.89
151 0.87
152 0.87
153 0.86
154 0.87
155 0.87
156 0.87
157 0.81
158 0.71
159 0.62
160 0.57
161 0.47
162 0.38
163 0.36
164 0.31
165 0.33
166 0.34
167 0.37
168 0.33
169 0.36
170 0.4
171 0.35
172 0.34
173 0.3
174 0.28
175 0.28
176 0.34
177 0.33
178 0.31
179 0.27
180 0.27
181 0.26
182 0.26
183 0.24
184 0.19
185 0.19
186 0.15
187 0.15
188 0.16
189 0.16
190 0.18
191 0.21
192 0.21
193 0.24
194 0.27
195 0.31
196 0.32
197 0.4
198 0.47
199 0.52
200 0.59
201 0.65
202 0.68
203 0.67
204 0.73
205 0.67
206 0.66
207 0.65
208 0.66
209 0.64
210 0.67
211 0.69
212 0.66
213 0.69
214 0.66
215 0.62
216 0.6
217 0.6
218 0.53
219 0.54
220 0.48
221 0.42
222 0.35
223 0.31
224 0.24
225 0.17
226 0.15
227 0.1
228 0.1
229 0.11
230 0.1
231 0.1
232 0.09
233 0.08