Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XLC3

Protein Details
Accession B7XLC3   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MQETKRSRRFKKTNGERFNDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
Gene Ontology GO:0000502  C:proteasome complex  
Amino Acid Sequences MQETKRSRRFKKTNGERFNDVVKEFVGEVKNNTRINYRDILMKGRYNLIDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.78
4 0.7
5 0.66
6 0.56
7 0.45
8 0.35
9 0.25
10 0.2
11 0.16
12 0.16
13 0.13
14 0.11
15 0.13
16 0.17
17 0.23
18 0.24
19 0.25
20 0.26
21 0.27
22 0.3
23 0.31
24 0.28
25 0.28
26 0.28
27 0.33
28 0.33
29 0.35
30 0.33
31 0.35
32 0.36