Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1R3R8U9

Protein Details
Accession A0A1R3R8U9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-50ESFPRANKPPKLGKPRKLRKQSNASTGTVHydrophilic
NLS Segment(s)
PositionSequence
26-41RANKPPKLGKPRKLRK
Subcellular Location(s) nucl 23, cyto_nucl 14.333, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGDKSPQDITSEPPEPPSSPTESFPRANKPPKLGKPRKLRKQSNASTGTVDPPPPPQEGQEEPNENPPQPGEENQPQQEQQEQLPSEENPPDPSTEPTAPSTHPEDDNNNNPENPQDTKPTMSTETEDVTSLTKDVGEKAAPVKGPVKEITTGGMDMRIDDEDLNWKSSDKEGSLQIRVRINLRAKVQLNLDARVKGEVVIGLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.32
4 0.31
5 0.3
6 0.29
7 0.32
8 0.35
9 0.37
10 0.41
11 0.42
12 0.47
13 0.5
14 0.57
15 0.59
16 0.6
17 0.66
18 0.71
19 0.78
20 0.8
21 0.8
22 0.82
23 0.87
24 0.9
25 0.9
26 0.9
27 0.89
28 0.9
29 0.88
30 0.87
31 0.8
32 0.71
33 0.64
34 0.55
35 0.48
36 0.39
37 0.32
38 0.23
39 0.22
40 0.23
41 0.22
42 0.21
43 0.19
44 0.23
45 0.25
46 0.28
47 0.3
48 0.31
49 0.3
50 0.38
51 0.38
52 0.33
53 0.3
54 0.27
55 0.23
56 0.21
57 0.22
58 0.21
59 0.26
60 0.3
61 0.32
62 0.34
63 0.32
64 0.31
65 0.32
66 0.26
67 0.21
68 0.21
69 0.2
70 0.18
71 0.19
72 0.19
73 0.18
74 0.19
75 0.18
76 0.15
77 0.15
78 0.16
79 0.15
80 0.16
81 0.18
82 0.17
83 0.19
84 0.18
85 0.19
86 0.17
87 0.19
88 0.2
89 0.18
90 0.18
91 0.18
92 0.2
93 0.22
94 0.29
95 0.29
96 0.27
97 0.25
98 0.24
99 0.23
100 0.23
101 0.22
102 0.17
103 0.18
104 0.19
105 0.21
106 0.22
107 0.23
108 0.23
109 0.2
110 0.2
111 0.17
112 0.17
113 0.16
114 0.15
115 0.13
116 0.11
117 0.1
118 0.09
119 0.07
120 0.07
121 0.07
122 0.07
123 0.09
124 0.08
125 0.09
126 0.1
127 0.13
128 0.13
129 0.15
130 0.18
131 0.18
132 0.21
133 0.21
134 0.22
135 0.2
136 0.21
137 0.21
138 0.17
139 0.17
140 0.14
141 0.14
142 0.11
143 0.1
144 0.11
145 0.1
146 0.09
147 0.08
148 0.09
149 0.15
150 0.16
151 0.18
152 0.17
153 0.17
154 0.18
155 0.21
156 0.23
157 0.18
158 0.2
159 0.25
160 0.29
161 0.35
162 0.38
163 0.4
164 0.41
165 0.41
166 0.41
167 0.42
168 0.43
169 0.43
170 0.43
171 0.47
172 0.44
173 0.46
174 0.47
175 0.47
176 0.44
177 0.43
178 0.42
179 0.35
180 0.34
181 0.31
182 0.29
183 0.21
184 0.19