Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1R3RGK4

Protein Details
Accession A0A1R3RGK4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
149-170ADVKQLRKKYHEKYKERNRVAAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000837  AP-1  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
GO:1900818  P:ochratoxin A biosynthetic process  
GO:0006357  P:regulation of transcription by RNA polymerase II  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
Amino Acid Sequences MEPALISPELLDGSSLLPHSSADESSSTGLSLGSLLSSSNDLSSETSMPQFEQLERMLGSPTIANHVDFTTQSTDLGFLSDPNITLSSIELTELFSIPSDNASLMPEPSRQPSPLKAPDLQTTPPATGLIDSEANPTSVPLGNSVEQSADVKQLRKKYHEKYKERNRVAAGKSRQKQVDLIELLQAEQREEERRRKALERELSQIHKELLDLKQELQHHIRIANCMTMMSHGAHMQTLGLLAQDMLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.08
6 0.11
7 0.12
8 0.11
9 0.12
10 0.12
11 0.13
12 0.15
13 0.15
14 0.12
15 0.11
16 0.1
17 0.08
18 0.07
19 0.06
20 0.05
21 0.04
22 0.05
23 0.05
24 0.07
25 0.07
26 0.07
27 0.07
28 0.08
29 0.09
30 0.11
31 0.12
32 0.12
33 0.13
34 0.13
35 0.13
36 0.15
37 0.16
38 0.14
39 0.16
40 0.15
41 0.15
42 0.15
43 0.16
44 0.14
45 0.12
46 0.12
47 0.1
48 0.1
49 0.12
50 0.13
51 0.12
52 0.12
53 0.13
54 0.13
55 0.12
56 0.14
57 0.13
58 0.13
59 0.12
60 0.12
61 0.12
62 0.1
63 0.11
64 0.09
65 0.06
66 0.07
67 0.07
68 0.07
69 0.08
70 0.09
71 0.08
72 0.08
73 0.08
74 0.07
75 0.07
76 0.07
77 0.06
78 0.06
79 0.07
80 0.07
81 0.06
82 0.05
83 0.06
84 0.05
85 0.06
86 0.05
87 0.05
88 0.05
89 0.06
90 0.07
91 0.07
92 0.08
93 0.1
94 0.11
95 0.13
96 0.15
97 0.15
98 0.17
99 0.19
100 0.26
101 0.29
102 0.31
103 0.31
104 0.32
105 0.33
106 0.34
107 0.32
108 0.27
109 0.22
110 0.19
111 0.17
112 0.15
113 0.11
114 0.09
115 0.08
116 0.07
117 0.07
118 0.07
119 0.09
120 0.09
121 0.09
122 0.09
123 0.08
124 0.08
125 0.08
126 0.08
127 0.08
128 0.1
129 0.11
130 0.11
131 0.11
132 0.1
133 0.09
134 0.1
135 0.09
136 0.12
137 0.13
138 0.17
139 0.2
140 0.27
141 0.31
142 0.37
143 0.45
144 0.49
145 0.58
146 0.65
147 0.71
148 0.75
149 0.83
150 0.86
151 0.81
152 0.77
153 0.7
154 0.68
155 0.62
156 0.61
157 0.58
158 0.57
159 0.59
160 0.61
161 0.58
162 0.51
163 0.5
164 0.43
165 0.43
166 0.35
167 0.31
168 0.27
169 0.25
170 0.24
171 0.23
172 0.2
173 0.12
174 0.11
175 0.12
176 0.17
177 0.23
178 0.31
179 0.36
180 0.4
181 0.45
182 0.5
183 0.55
184 0.58
185 0.62
186 0.58
187 0.57
188 0.59
189 0.58
190 0.54
191 0.49
192 0.4
193 0.31
194 0.27
195 0.25
196 0.22
197 0.24
198 0.23
199 0.22
200 0.26
201 0.28
202 0.33
203 0.32
204 0.33
205 0.29
206 0.31
207 0.31
208 0.3
209 0.3
210 0.27
211 0.24
212 0.2
213 0.19
214 0.17
215 0.17
216 0.15
217 0.15
218 0.14
219 0.14
220 0.14
221 0.13
222 0.12
223 0.1
224 0.09
225 0.07
226 0.06
227 0.06