Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XJX6

Protein Details
Accession B7XJX6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGRKKSRRTTIKKRSIKPSNNKFDCPKHydrophilic
NLS Segment(s)
PositionSequence
3-17RKKSRRTTIKKRSIK
Subcellular Location(s) mito_nucl 12.999, mito 12.5, nucl 12, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGRKKSRRTTIKKRSIKPSNNKFDCPKCNHEKVVSCKINKNCKIGTAYCSVCESIYKCEINSLDQFVDIYHKWIDELINK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.89
4 0.89
5 0.88
6 0.88
7 0.84
8 0.81
9 0.77
10 0.75
11 0.73
12 0.69
13 0.66
14 0.63
15 0.63
16 0.61
17 0.59
18 0.58
19 0.56
20 0.6
21 0.57
22 0.51
23 0.53
24 0.57
25 0.62
26 0.59
27 0.56
28 0.45
29 0.43
30 0.45
31 0.39
32 0.35
33 0.3
34 0.27
35 0.23
36 0.24
37 0.21
38 0.17
39 0.18
40 0.16
41 0.15
42 0.19
43 0.19
44 0.18
45 0.21
46 0.22
47 0.24
48 0.24
49 0.23
50 0.19
51 0.18
52 0.19
53 0.15
54 0.19
55 0.16
56 0.16
57 0.14
58 0.14
59 0.14
60 0.15