Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1R3S2P5

Protein Details
Accession A0A1R3S2P5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-51ESRPRETKPLRRTLRRSRTVYRQFPRRSRDGBasic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MKPISTNQTPGCLQPGNLETESRPRETKPLRRTLRRSRTVYRQFPRRSRDGQSER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.24
4 0.24
5 0.23
6 0.19
7 0.27
8 0.29
9 0.26
10 0.26
11 0.22
12 0.3
13 0.37
14 0.45
15 0.45
16 0.53
17 0.58
18 0.66
19 0.75
20 0.77
21 0.8
22 0.8
23 0.79
24 0.76
25 0.79
26 0.8
27 0.81
28 0.79
29 0.79
30 0.79
31 0.81
32 0.81
33 0.78
34 0.73
35 0.7