Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XK24

Protein Details
Accession B7XK24   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-37SEKSEFKTKNNKNEKYNEKKIVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 10, mito 3
Family & Domain DBs
Amino Acid Sequences MFNDNIDIKYTELKTSEKSEFKTKNNKNEKYNEKKIVTEYLKSQNGIEFLSNKFILNTEKSIIEKVDDIIDFYITWASEIPVRRNLYLNKYDWLKKVEEFCEKHTNVLNEIPIKNKFQNNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.37
4 0.35
5 0.38
6 0.45
7 0.5
8 0.55
9 0.63
10 0.65
11 0.68
12 0.74
13 0.77
14 0.75
15 0.78
16 0.8
17 0.79
18 0.81
19 0.79
20 0.7
21 0.65
22 0.6
23 0.59
24 0.52
25 0.44
26 0.39
27 0.39
28 0.39
29 0.37
30 0.35
31 0.27
32 0.25
33 0.24
34 0.2
35 0.13
36 0.12
37 0.15
38 0.15
39 0.13
40 0.12
41 0.12
42 0.14
43 0.13
44 0.14
45 0.12
46 0.12
47 0.13
48 0.13
49 0.12
50 0.11
51 0.09
52 0.09
53 0.09
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.05
62 0.06
63 0.05
64 0.05
65 0.09
66 0.11
67 0.14
68 0.2
69 0.23
70 0.23
71 0.28
72 0.31
73 0.35
74 0.38
75 0.38
76 0.35
77 0.39
78 0.42
79 0.41
80 0.41
81 0.36
82 0.34
83 0.38
84 0.39
85 0.43
86 0.42
87 0.44
88 0.51
89 0.49
90 0.49
91 0.48
92 0.45
93 0.39
94 0.39
95 0.38
96 0.34
97 0.35
98 0.37
99 0.35
100 0.38
101 0.42