Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XL98

Protein Details
Accession B7XL98   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
66-87FPSPGGGKKKKPRGGGLEKKKKBasic
NLS Segment(s)
PositionSequence
6-20KKKKNPPRGGGGAPS
73-90GGXKKKKPRGGGLEKKKK
Subcellular Location(s) mito 18, cyto_nucl 5, nucl 4.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MFVGEKKKKNPPRGGGGAPSPGFFGGYEKKKPPLFYKKEGAPPFFFFFCKEHPHIXAFFXRGCCFFFFPSPGGGXKKKKPRGGGLEKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.68
3 0.62
4 0.58
5 0.48
6 0.41
7 0.32
8 0.25
9 0.21
10 0.16
11 0.17
12 0.18
13 0.22
14 0.27
15 0.29
16 0.35
17 0.37
18 0.4
19 0.45
20 0.48
21 0.5
22 0.51
23 0.55
24 0.55
25 0.61
26 0.61
27 0.56
28 0.47
29 0.44
30 0.4
31 0.34
32 0.29
33 0.22
34 0.21
35 0.2
36 0.23
37 0.22
38 0.24
39 0.25
40 0.28
41 0.27
42 0.28
43 0.29
44 0.24
45 0.26
46 0.24
47 0.24
48 0.22
49 0.24
50 0.22
51 0.21
52 0.23
53 0.19
54 0.2
55 0.23
56 0.27
57 0.32
58 0.36
59 0.44
60 0.52
61 0.61
62 0.65
63 0.68
64 0.72
65 0.75
66 0.8
67 0.82