Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1R3RAT5

Protein Details
Accession A0A1R3RAT5    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
201-229SSTTVDPSFPPRPKKNRRKSHRICGSLFPHydrophilic
NLS Segment(s)
PositionSequence
52-60WGRRSKGKK
211-220PRPKKNRRKS
Subcellular Location(s) nucl 17, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
Amino Acid Sequences MSDPTLYLYTSLTAGSSHIVTATARLETILKANKLPFRAIDVATDEVARKLWGRRSKGKKLPGLVKFGTVVGDLEQVEEWNEYGELRMQINSVEDYDSIPASSTTTAQPETPSATSTPTPETATLKQSTIKIQSPPSKETPKDSSIAVAMRQASEEAAARAKGNSSQPPAAKEPIPAVTEKKETPAADEQSQTGKEDTDWSSTTVDPSFPPRPKKNRRKSHRICGSLFPGVNKIFYNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.09
4 0.08
5 0.08
6 0.09
7 0.08
8 0.1
9 0.11
10 0.1
11 0.1
12 0.1
13 0.11
14 0.11
15 0.18
16 0.22
17 0.22
18 0.25
19 0.3
20 0.34
21 0.35
22 0.36
23 0.31
24 0.31
25 0.33
26 0.3
27 0.27
28 0.26
29 0.26
30 0.24
31 0.24
32 0.18
33 0.15
34 0.14
35 0.13
36 0.12
37 0.15
38 0.23
39 0.3
40 0.37
41 0.47
42 0.56
43 0.66
44 0.72
45 0.76
46 0.74
47 0.74
48 0.77
49 0.71
50 0.69
51 0.59
52 0.52
53 0.44
54 0.37
55 0.3
56 0.21
57 0.16
58 0.09
59 0.1
60 0.09
61 0.08
62 0.08
63 0.07
64 0.08
65 0.08
66 0.07
67 0.06
68 0.06
69 0.05
70 0.05
71 0.08
72 0.08
73 0.09
74 0.09
75 0.08
76 0.09
77 0.1
78 0.1
79 0.08
80 0.08
81 0.07
82 0.08
83 0.08
84 0.08
85 0.07
86 0.06
87 0.06
88 0.06
89 0.06
90 0.07
91 0.07
92 0.09
93 0.09
94 0.09
95 0.1
96 0.1
97 0.12
98 0.11
99 0.11
100 0.1
101 0.12
102 0.12
103 0.13
104 0.13
105 0.12
106 0.13
107 0.13
108 0.16
109 0.16
110 0.19
111 0.19
112 0.18
113 0.18
114 0.19
115 0.21
116 0.22
117 0.22
118 0.22
119 0.27
120 0.33
121 0.35
122 0.38
123 0.41
124 0.43
125 0.41
126 0.44
127 0.43
128 0.39
129 0.36
130 0.32
131 0.27
132 0.22
133 0.22
134 0.17
135 0.14
136 0.12
137 0.11
138 0.11
139 0.1
140 0.08
141 0.08
142 0.08
143 0.07
144 0.08
145 0.09
146 0.09
147 0.09
148 0.1
149 0.12
150 0.16
151 0.2
152 0.23
153 0.27
154 0.29
155 0.33
156 0.36
157 0.35
158 0.32
159 0.28
160 0.26
161 0.26
162 0.25
163 0.22
164 0.22
165 0.23
166 0.26
167 0.25
168 0.26
169 0.27
170 0.26
171 0.29
172 0.34
173 0.34
174 0.33
175 0.34
176 0.32
177 0.32
178 0.33
179 0.29
180 0.22
181 0.18
182 0.15
183 0.19
184 0.2
185 0.19
186 0.2
187 0.2
188 0.21
189 0.21
190 0.23
191 0.19
192 0.18
193 0.15
194 0.22
195 0.29
196 0.34
197 0.43
198 0.51
199 0.61
200 0.71
201 0.81
202 0.85
203 0.88
204 0.91
205 0.93
206 0.93
207 0.94
208 0.93
209 0.89
210 0.82
211 0.79
212 0.75
213 0.71
214 0.63
215 0.53
216 0.49
217 0.42
218 0.4