Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1R3RGT0

Protein Details
Accession A0A1R3RGT0    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-27APVSGVKKNKKPASLRPRASHydrophilic
NLS Segment(s)
PositionSequence
14-37KKNKKPASLRPRASPFAAHARRKA
Subcellular Location(s) mito 22, cyto_nucl 3, nucl 2.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018865  Ser/Thr_kinase_19  
Pfam View protein in Pfam  
PF10494  Stk19  
Amino Acid Sequences MPLRITSAPVSGVKKNKKPASLRPRASPFAAHARRKASAPSSSGASKPYGEHEYGQGPLPDLGISRYIPETAPVNDVVQALQYIRHSMFEDLPRRTGMSSTRTAEVLNFRRSLPPLASVAHVHTLLNSPTKVEKEIMELVHAGQVRRLIVPGRGNDAAGLGDCLVLTEEWERLVQDSPALDVSLKGKFLELLGRLGNACAIPGAAFSLPETMALVRAGFLVSSSTLAKGSSSLASLPVFAATSTTTTTTPASSSARRCGTEQTADVGSSCRSQLHTATLFLSLPNTGPYLRLLGAGRSHLLSVLKRAGSSEVPGHLLRDRWNGAVKNEKNFSVAKRARGEFAGILPGRTKRWKELYGMNFRWVLEEALGAGLIEIFDTGSVGPGVRCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.64
3 0.67
4 0.71
5 0.74
6 0.78
7 0.8
8 0.81
9 0.79
10 0.79
11 0.79
12 0.75
13 0.69
14 0.61
15 0.55
16 0.55
17 0.59
18 0.55
19 0.53
20 0.54
21 0.54
22 0.53
23 0.53
24 0.48
25 0.45
26 0.42
27 0.39
28 0.38
29 0.38
30 0.37
31 0.33
32 0.29
33 0.25
34 0.23
35 0.26
36 0.25
37 0.25
38 0.25
39 0.26
40 0.26
41 0.26
42 0.27
43 0.22
44 0.2
45 0.18
46 0.17
47 0.14
48 0.12
49 0.12
50 0.12
51 0.11
52 0.12
53 0.12
54 0.13
55 0.13
56 0.14
57 0.16
58 0.15
59 0.17
60 0.16
61 0.16
62 0.17
63 0.17
64 0.15
65 0.13
66 0.12
67 0.09
68 0.11
69 0.1
70 0.12
71 0.12
72 0.13
73 0.14
74 0.16
75 0.21
76 0.27
77 0.33
78 0.33
79 0.34
80 0.33
81 0.33
82 0.31
83 0.28
84 0.25
85 0.24
86 0.27
87 0.28
88 0.28
89 0.28
90 0.27
91 0.27
92 0.32
93 0.33
94 0.31
95 0.3
96 0.3
97 0.33
98 0.34
99 0.35
100 0.27
101 0.23
102 0.21
103 0.21
104 0.21
105 0.19
106 0.19
107 0.18
108 0.17
109 0.14
110 0.12
111 0.14
112 0.14
113 0.16
114 0.14
115 0.13
116 0.15
117 0.17
118 0.18
119 0.17
120 0.16
121 0.17
122 0.21
123 0.19
124 0.18
125 0.17
126 0.15
127 0.17
128 0.18
129 0.13
130 0.11
131 0.12
132 0.12
133 0.12
134 0.13
135 0.11
136 0.14
137 0.18
138 0.18
139 0.21
140 0.21
141 0.21
142 0.2
143 0.19
144 0.15
145 0.1
146 0.09
147 0.05
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.05
155 0.05
156 0.05
157 0.06
158 0.06
159 0.07
160 0.08
161 0.07
162 0.07
163 0.07
164 0.07
165 0.07
166 0.07
167 0.06
168 0.06
169 0.08
170 0.08
171 0.08
172 0.08
173 0.07
174 0.07
175 0.08
176 0.1
177 0.1
178 0.1
179 0.1
180 0.1
181 0.1
182 0.1
183 0.1
184 0.07
185 0.06
186 0.04
187 0.04
188 0.03
189 0.03
190 0.04
191 0.04
192 0.04
193 0.04
194 0.05
195 0.05
196 0.05
197 0.06
198 0.05
199 0.05
200 0.05
201 0.05
202 0.04
203 0.05
204 0.05
205 0.04
206 0.04
207 0.04
208 0.04
209 0.05
210 0.06
211 0.06
212 0.06
213 0.06
214 0.06
215 0.06
216 0.07
217 0.07
218 0.07
219 0.07
220 0.08
221 0.08
222 0.08
223 0.08
224 0.07
225 0.06
226 0.06
227 0.06
228 0.05
229 0.06
230 0.07
231 0.08
232 0.08
233 0.09
234 0.1
235 0.1
236 0.1
237 0.12
238 0.14
239 0.18
240 0.2
241 0.26
242 0.29
243 0.3
244 0.3
245 0.33
246 0.34
247 0.33
248 0.31
249 0.27
250 0.24
251 0.23
252 0.22
253 0.19
254 0.15
255 0.12
256 0.12
257 0.1
258 0.11
259 0.12
260 0.14
261 0.18
262 0.19
263 0.19
264 0.2
265 0.2
266 0.18
267 0.17
268 0.16
269 0.1
270 0.09
271 0.09
272 0.09
273 0.08
274 0.09
275 0.09
276 0.11
277 0.11
278 0.14
279 0.13
280 0.15
281 0.16
282 0.17
283 0.17
284 0.15
285 0.15
286 0.14
287 0.16
288 0.14
289 0.17
290 0.21
291 0.2
292 0.2
293 0.21
294 0.22
295 0.2
296 0.22
297 0.21
298 0.17
299 0.2
300 0.21
301 0.22
302 0.21
303 0.22
304 0.23
305 0.27
306 0.27
307 0.27
308 0.33
309 0.34
310 0.37
311 0.45
312 0.45
313 0.46
314 0.47
315 0.45
316 0.41
317 0.41
318 0.4
319 0.4
320 0.41
321 0.41
322 0.46
323 0.47
324 0.46
325 0.45
326 0.45
327 0.35
328 0.32
329 0.33
330 0.26
331 0.25
332 0.26
333 0.28
334 0.3
335 0.36
336 0.39
337 0.38
338 0.46
339 0.5
340 0.52
341 0.59
342 0.63
343 0.66
344 0.65
345 0.61
346 0.55
347 0.5
348 0.47
349 0.39
350 0.3
351 0.2
352 0.17
353 0.13
354 0.11
355 0.11
356 0.08
357 0.07
358 0.06
359 0.05
360 0.05
361 0.04
362 0.03
363 0.03
364 0.04
365 0.04
366 0.05
367 0.06
368 0.07