Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A9CTU7

Protein Details
Accession A9CTU7   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MYTSEKKKIKVAKKGEKTIVHydrophilic
NLS Segment(s)
PositionSequence
7-13KKIKVAK
Subcellular Location(s) cyto 21.5, cyto_nucl 13, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009001  Transl_elong_EF1A/Init_IF2_C  
IPR004160  Transl_elong_EFTu/EF1A_C  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF03143  GTP_EFTU_D3  
Amino Acid Sequences MYTSEKKKIKVAKKGEKTIVVFDLEDEVILPTNPSKEGRIKFSLRDEDITVGVGEIIKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.76
4 0.68
5 0.61
6 0.52
7 0.42
8 0.32
9 0.24
10 0.21
11 0.14
12 0.12
13 0.09
14 0.07
15 0.06
16 0.06
17 0.05
18 0.04
19 0.05
20 0.06
21 0.07
22 0.1
23 0.17
24 0.2
25 0.26
26 0.32
27 0.33
28 0.36
29 0.42
30 0.47
31 0.42
32 0.42
33 0.38
34 0.33
35 0.31
36 0.28
37 0.21
38 0.14
39 0.12
40 0.09