Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A9CS03

Protein Details
Accession A9CS03    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
69-95LVLRLRGGKKKKKKEYLTPKKVKVPRKBasic
NLS Segment(s)
PositionSequence
73-97LRGGKKKKKKEYLTPKKVKVPRKNI
Subcellular Location(s) cyto_nucl 17, nucl 14.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038582  S27a-like_sf  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR019954  Ubiquitin_CS  
IPR019956  Ubiquitin_dom  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS00299  UBIQUITIN_1  
PS50053  UBIQUITIN_2  
CDD cd01803  Ubl_ubiquitin  
Amino Acid Sequences MQIFVKTLTGKTITLEVETSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGKKKKKKEYLTPKKVKVPRKNIKLGYLKNFSLTTDGNIIISKESCSKCGVGYFLSPKGQCGKCKEESDKLIKNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.16
4 0.16
5 0.15
6 0.16
7 0.12
8 0.11
9 0.11
10 0.12
11 0.13
12 0.11
13 0.14
14 0.16
15 0.2
16 0.24
17 0.28
18 0.32
19 0.32
20 0.41
21 0.44
22 0.44
23 0.42
24 0.42
25 0.42
26 0.4
27 0.38
28 0.29
29 0.26
30 0.26
31 0.25
32 0.22
33 0.23
34 0.18
35 0.21
36 0.21
37 0.19
38 0.17
39 0.17
40 0.16
41 0.14
42 0.14
43 0.11
44 0.17
45 0.18
46 0.19
47 0.21
48 0.2
49 0.19
50 0.19
51 0.2
52 0.16
53 0.15
54 0.12
55 0.14
56 0.15
57 0.15
58 0.19
59 0.2
60 0.19
61 0.24
62 0.33
63 0.4
64 0.48
65 0.58
66 0.65
67 0.72
68 0.77
69 0.82
70 0.85
71 0.87
72 0.88
73 0.86
74 0.81
75 0.8
76 0.8
77 0.8
78 0.78
79 0.78
80 0.77
81 0.76
82 0.8
83 0.73
84 0.75
85 0.74
86 0.69
87 0.66
88 0.61
89 0.52
90 0.46
91 0.44
92 0.35
93 0.3
94 0.24
95 0.18
96 0.15
97 0.15
98 0.13
99 0.13
100 0.13
101 0.11
102 0.11
103 0.11
104 0.16
105 0.17
106 0.18
107 0.2
108 0.2
109 0.2
110 0.22
111 0.22
112 0.16
113 0.21
114 0.24
115 0.26
116 0.31
117 0.3
118 0.3
119 0.38
120 0.4
121 0.41
122 0.44
123 0.48
124 0.5
125 0.58
126 0.63
127 0.63
128 0.66
129 0.7