Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1R3RYH2

Protein Details
Accession A0A1R3RYH2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-40KIPWRLSAPQKARQRKRLRGVDRVVHydrophilic
74-103DKYTIFDKKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
81-95KKEKKYRKGIHKLPK
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MMFKPSSPLFSGLLWKIPWRLSAPQKARQRKRLRGVDRVVDTVSAALERNGYTTKSVERWYNEMPREEEMLPKDKYTIFDKKEKKYRKGIHKLPKWTRVSQRVNPAGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.25
4 0.24
5 0.26
6 0.24
7 0.3
8 0.35
9 0.44
10 0.49
11 0.55
12 0.64
13 0.72
14 0.77
15 0.79
16 0.81
17 0.81
18 0.85
19 0.86
20 0.83
21 0.81
22 0.78
23 0.75
24 0.67
25 0.59
26 0.48
27 0.38
28 0.31
29 0.22
30 0.16
31 0.09
32 0.07
33 0.05
34 0.05
35 0.05
36 0.06
37 0.07
38 0.08
39 0.08
40 0.09
41 0.1
42 0.12
43 0.14
44 0.16
45 0.17
46 0.21
47 0.25
48 0.31
49 0.32
50 0.32
51 0.32
52 0.3
53 0.32
54 0.28
55 0.27
56 0.23
57 0.26
58 0.24
59 0.23
60 0.22
61 0.2
62 0.23
63 0.26
64 0.32
65 0.31
66 0.39
67 0.47
68 0.55
69 0.64
70 0.7
71 0.71
72 0.73
73 0.79
74 0.81
75 0.84
76 0.85
77 0.86
78 0.85
79 0.89
80 0.88
81 0.88
82 0.83
83 0.8
84 0.8
85 0.8
86 0.8
87 0.76
88 0.78