Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1R3RRC5

Protein Details
Accession A0A1R3RRC5   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
74-109GKIVRVRSREGRRNRAPPPRIRYNKDGKKLNPPQAAHydrophilic
NLS Segment(s)
PositionSequence
78-105RVRSREGRRNRAPPPRIRYNKDGKKLNP
Subcellular Location(s) mito 12.5, mito_nucl 11, nucl 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences SGRNKNGRGHVKPVRCSNCARCTPKDKAIKRFTIRNMVESAAIRDISDASVFTDYAVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRIRYNKDGKKLNPPQAAKAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.65
3 0.67
4 0.66
5 0.66
6 0.68
7 0.67
8 0.63
9 0.64
10 0.68
11 0.7
12 0.72
13 0.69
14 0.7
15 0.72
16 0.74
17 0.72
18 0.72
19 0.68
20 0.68
21 0.61
22 0.54
23 0.47
24 0.38
25 0.35
26 0.28
27 0.25
28 0.16
29 0.15
30 0.12
31 0.1
32 0.1
33 0.08
34 0.08
35 0.06
36 0.05
37 0.06
38 0.06
39 0.06
40 0.09
41 0.08
42 0.09
43 0.09
44 0.09
45 0.09
46 0.1
47 0.12
48 0.15
49 0.16
50 0.19
51 0.21
52 0.22
53 0.23
54 0.24
55 0.22
56 0.19
57 0.19
58 0.18
59 0.19
60 0.19
61 0.21
62 0.22
63 0.28
64 0.31
65 0.31
66 0.35
67 0.4
68 0.49
69 0.55
70 0.61
71 0.65
72 0.69
73 0.75
74 0.8
75 0.81
76 0.8
77 0.8
78 0.79
79 0.8
80 0.8
81 0.78
82 0.78
83 0.79
84 0.8
85 0.8
86 0.81
87 0.74
88 0.76
89 0.79
90 0.81
91 0.79
92 0.72