Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VB13

Protein Details
Accession G0VB13   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
51-75LGYRRRSSHHHGRPKVKHNKPKVTTBasic
NLS Segment(s)
PositionSequence
55-71RRSSHHHGRPKVKHNKP
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR031456  Caf20  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005845  C:mRNA cap binding complex  
GO:0003743  F:translation initiation factor activity  
GO:0017148  P:negative regulation of translation  
KEGG ncs:NCAS_0B00520  -  
Pfam View protein in Pfam  
PF17052  CAF20  
Amino Acid Sequences MYKYTIDELLHLKPSETMTPNFDAVEFRSIIEKVKQLLALREEEFHSAHPLGYRRRSSHHHGRPKVKHNKPKVTTDEDGWSTLETKKSEDEEGAIAVDGEKPFIATATSASSIAQETMKVKPNNKNISSSRPADTKDIVADKQIHGFNTFAALESDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.3
4 0.28
5 0.27
6 0.3
7 0.3
8 0.28
9 0.26
10 0.21
11 0.19
12 0.21
13 0.17
14 0.14
15 0.16
16 0.16
17 0.18
18 0.2
19 0.2
20 0.18
21 0.2
22 0.23
23 0.22
24 0.26
25 0.26
26 0.26
27 0.24
28 0.24
29 0.23
30 0.22
31 0.21
32 0.17
33 0.18
34 0.15
35 0.15
36 0.16
37 0.2
38 0.24
39 0.3
40 0.34
41 0.32
42 0.37
43 0.42
44 0.47
45 0.54
46 0.58
47 0.62
48 0.65
49 0.73
50 0.77
51 0.82
52 0.85
53 0.83
54 0.82
55 0.81
56 0.84
57 0.77
58 0.77
59 0.72
60 0.68
61 0.6
62 0.52
63 0.46
64 0.36
65 0.33
66 0.25
67 0.2
68 0.14
69 0.15
70 0.16
71 0.12
72 0.13
73 0.14
74 0.15
75 0.15
76 0.14
77 0.14
78 0.11
79 0.11
80 0.1
81 0.08
82 0.06
83 0.06
84 0.07
85 0.06
86 0.06
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.04
93 0.05
94 0.07
95 0.08
96 0.08
97 0.08
98 0.09
99 0.09
100 0.1
101 0.09
102 0.08
103 0.1
104 0.14
105 0.22
106 0.25
107 0.31
108 0.39
109 0.48
110 0.56
111 0.57
112 0.6
113 0.56
114 0.61
115 0.62
116 0.57
117 0.51
118 0.45
119 0.45
120 0.42
121 0.4
122 0.33
123 0.32
124 0.32
125 0.29
126 0.3
127 0.3
128 0.27
129 0.32
130 0.32
131 0.27
132 0.25
133 0.25
134 0.2
135 0.21
136 0.2
137 0.15
138 0.14
139 0.14