Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q8RZ99

Protein Details
Accession A0A1Q8RZ99    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-44ILPSHVNNKPRSRRPKKDTKEVHKAVHydrophilic
NLS Segment(s)
PositionSequence
27-35KPRSRRPKK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MAPNTDPVQRAPNDTTLTILPSHVNNKPRSRRPKKDTKEVHKAVEAQVCRNRYRREKNCADIAGDLSKEGINVSASTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.25
4 0.25
5 0.2
6 0.18
7 0.14
8 0.14
9 0.18
10 0.21
11 0.27
12 0.32
13 0.41
14 0.49
15 0.58
16 0.67
17 0.73
18 0.79
19 0.8
20 0.85
21 0.83
22 0.84
23 0.85
24 0.82
25 0.83
26 0.75
27 0.69
28 0.6
29 0.54
30 0.47
31 0.42
32 0.33
33 0.28
34 0.29
35 0.3
36 0.31
37 0.37
38 0.42
39 0.46
40 0.57
41 0.6
42 0.65
43 0.7
44 0.73
45 0.73
46 0.67
47 0.59
48 0.5
49 0.44
50 0.37
51 0.29
52 0.23
53 0.17
54 0.15
55 0.13
56 0.11
57 0.1
58 0.08