Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VD92

Protein Details
Accession G0VD92    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
113-133TSTGRKFERARGKRRSKGFKVBasic
NLS Segment(s)
PositionSequence
101-133GMGPHKNKAPRITSTGRKFERARGKRRSKGFKV
Subcellular Location(s) mito 18, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncs:NCAS_0C04640  -  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
Amino Acid Sequences MSKINRPPVSVSRISRALKQEGAAAKTIVVVGTVTDDARVFELPKTTVAALRFTSSARARIVKAGGECITLDQLAVRAPKGQNTLILRGPRNSREAVRHFGMGPHKNKAPRITSTGRKFERARGKRRSKGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.51
4 0.48
5 0.43
6 0.4
7 0.39
8 0.36
9 0.36
10 0.31
11 0.26
12 0.21
13 0.19
14 0.19
15 0.13
16 0.08
17 0.06
18 0.04
19 0.06
20 0.07
21 0.06
22 0.07
23 0.07
24 0.07
25 0.08
26 0.09
27 0.08
28 0.08
29 0.11
30 0.11
31 0.12
32 0.13
33 0.12
34 0.14
35 0.14
36 0.16
37 0.14
38 0.15
39 0.15
40 0.13
41 0.18
42 0.16
43 0.18
44 0.18
45 0.19
46 0.18
47 0.2
48 0.21
49 0.17
50 0.16
51 0.16
52 0.14
53 0.13
54 0.12
55 0.1
56 0.1
57 0.07
58 0.07
59 0.04
60 0.05
61 0.06
62 0.06
63 0.06
64 0.1
65 0.1
66 0.14
67 0.17
68 0.17
69 0.2
70 0.23
71 0.26
72 0.26
73 0.31
74 0.29
75 0.31
76 0.35
77 0.32
78 0.33
79 0.32
80 0.31
81 0.34
82 0.38
83 0.39
84 0.37
85 0.36
86 0.33
87 0.35
88 0.4
89 0.4
90 0.39
91 0.39
92 0.42
93 0.45
94 0.49
95 0.51
96 0.48
97 0.45
98 0.49
99 0.51
100 0.56
101 0.6
102 0.66
103 0.62
104 0.64
105 0.62
106 0.64
107 0.67
108 0.67
109 0.68
110 0.69
111 0.77
112 0.78
113 0.87