Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q8RQM6

Protein Details
Accession A0A1Q8RQM6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-28QDGVRLQRHKQRRVADKERKRAVRABasic
NLS Segment(s)
PositionSequence
13-24KQRRVADKERKR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MDPQDGVRLQRHKQRRVADKERKRAVRACDGCRRLKEKCDGGVPCRRCTRLRRQCEFLTPTTRDEPAPESSTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.71
3 0.76
4 0.81
5 0.83
6 0.83
7 0.86
8 0.87
9 0.83
10 0.77
11 0.72
12 0.67
13 0.67
14 0.63
15 0.6
16 0.6
17 0.6
18 0.6
19 0.59
20 0.57
21 0.49
22 0.47
23 0.47
24 0.41
25 0.38
26 0.4
27 0.38
28 0.39
29 0.45
30 0.43
31 0.43
32 0.44
33 0.44
34 0.43
35 0.48
36 0.54
37 0.56
38 0.64
39 0.65
40 0.67
41 0.68
42 0.71
43 0.69
44 0.63
45 0.6
46 0.52
47 0.5
48 0.46
49 0.44
50 0.35
51 0.33
52 0.32
53 0.3