Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q8RRD0

Protein Details
Accession A0A1Q8RRD0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKRNRKSSQIKFKVRCQRHHydrophilic
NLS Segment(s)
PositionSequence
21-30SSARIKRNRK
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREIADIKQFIEIARRKDASSARIKRNRKSSQIKFKVRCQRHLYTLVLKDSEKAEKLKQSLPPQLQIKDVSAKGKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.34
4 0.32
5 0.38
6 0.41
7 0.39
8 0.45
9 0.49
10 0.53
11 0.61
12 0.66
13 0.68
14 0.74
15 0.74
16 0.73
17 0.75
18 0.75
19 0.77
20 0.82
21 0.85
22 0.79
23 0.81
24 0.81
25 0.74
26 0.73
27 0.68
28 0.62
29 0.57
30 0.57
31 0.5
32 0.46
33 0.46
34 0.4
35 0.34
36 0.3
37 0.27
38 0.24
39 0.25
40 0.21
41 0.2
42 0.22
43 0.26
44 0.29
45 0.33
46 0.38
47 0.42
48 0.49
49 0.5
50 0.54
51 0.54
52 0.53
53 0.51
54 0.46
55 0.42
56 0.4
57 0.39
58 0.36