Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q8RVS3

Protein Details
Accession A0A1Q8RVS3   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
122-143PEDLVRKRAKNRKQLHQPLGSCHydrophilic
NLS Segment(s)
PositionSequence
48-57KPKPKAKAGK
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MGLRRKISEMDLRMSPPKRLALTQSQSDLSISTMSVNRNPTTVKGEDKPKPKAKAGKTRWVSQLKDWFNTGEPSAHDWKRMKKQEFQRHGVAMNDPEASVKLHAPIGAIPEGAIKPSSGPDPEDLVRKRAKNRKQLHQPLGSCDRVSGSISSESSSSSKEVNPIAPWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.43
3 0.38
4 0.39
5 0.37
6 0.37
7 0.39
8 0.41
9 0.45
10 0.46
11 0.45
12 0.4
13 0.38
14 0.36
15 0.3
16 0.21
17 0.15
18 0.11
19 0.1
20 0.12
21 0.14
22 0.17
23 0.21
24 0.2
25 0.21
26 0.22
27 0.22
28 0.25
29 0.25
30 0.27
31 0.28
32 0.37
33 0.42
34 0.49
35 0.56
36 0.58
37 0.61
38 0.62
39 0.66
40 0.66
41 0.7
42 0.7
43 0.71
44 0.67
45 0.68
46 0.7
47 0.67
48 0.6
49 0.55
50 0.57
51 0.5
52 0.47
53 0.42
54 0.35
55 0.29
56 0.28
57 0.23
58 0.15
59 0.13
60 0.16
61 0.21
62 0.2
63 0.24
64 0.26
65 0.32
66 0.4
67 0.48
68 0.48
69 0.49
70 0.6
71 0.65
72 0.7
73 0.68
74 0.62
75 0.54
76 0.52
77 0.45
78 0.36
79 0.26
80 0.19
81 0.15
82 0.11
83 0.1
84 0.09
85 0.09
86 0.08
87 0.08
88 0.07
89 0.07
90 0.08
91 0.08
92 0.08
93 0.1
94 0.09
95 0.09
96 0.08
97 0.09
98 0.09
99 0.09
100 0.09
101 0.06
102 0.07
103 0.08
104 0.1
105 0.09
106 0.11
107 0.12
108 0.16
109 0.17
110 0.25
111 0.25
112 0.29
113 0.34
114 0.37
115 0.46
116 0.51
117 0.59
118 0.61
119 0.69
120 0.75
121 0.8
122 0.86
123 0.85
124 0.84
125 0.77
126 0.74
127 0.72
128 0.64
129 0.52
130 0.42
131 0.35
132 0.27
133 0.27
134 0.2
135 0.16
136 0.18
137 0.18
138 0.19
139 0.17
140 0.18
141 0.17
142 0.18
143 0.17
144 0.15
145 0.16
146 0.19
147 0.22
148 0.23