Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q8S800

Protein Details
Accession A0A1Q8S800   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-45RYATKHPTPKEKPWSSRGPKBasic
NLS Segment(s)
Subcellular Location(s) cyto 8.5cyto_nucl 8.5, nucl 7.5, mito 5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF03372  Exo_endo_phos  
CDD cd09083  EEP-1  
Amino Acid Sequences MLVKLDTPATAAVIPMLLRIVSQNVRYATKHPTPKEKPWSSRGPKLCNQLDFITTGHESAFICLQEVLYSQLQDIQSYLGPAWSHIGLGRDDGKRGGEFSPIFYQVDRWACERNETIWLSKTPEKPSRGWDAALKRVVTVGEFVDRRTASRVVVMSTHFDHQGVVAREESAKLILEIVREWSKGANGKPPTAVLLAGDFNSTPDDNAYRTMVAPESGMADVSTKVAREKRYGNELTYTSFDEPNEKPKRIDFLFVKDPSPVTIRTFGVLSNRFDDGVYLSDHRPVVADVEIPVLRTVSMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.06
5 0.06
6 0.08
7 0.13
8 0.16
9 0.17
10 0.23
11 0.25
12 0.29
13 0.3
14 0.33
15 0.36
16 0.41
17 0.48
18 0.49
19 0.57
20 0.61
21 0.7
22 0.78
23 0.79
24 0.77
25 0.76
26 0.81
27 0.78
28 0.8
29 0.78
30 0.75
31 0.72
32 0.74
33 0.73
34 0.64
35 0.6
36 0.52
37 0.45
38 0.38
39 0.32
40 0.26
41 0.21
42 0.18
43 0.14
44 0.14
45 0.12
46 0.12
47 0.14
48 0.1
49 0.11
50 0.1
51 0.1
52 0.09
53 0.09
54 0.12
55 0.11
56 0.11
57 0.1
58 0.14
59 0.15
60 0.14
61 0.14
62 0.11
63 0.11
64 0.11
65 0.11
66 0.09
67 0.09
68 0.09
69 0.11
70 0.09
71 0.09
72 0.1
73 0.12
74 0.1
75 0.12
76 0.18
77 0.16
78 0.17
79 0.18
80 0.18
81 0.17
82 0.18
83 0.17
84 0.16
85 0.16
86 0.18
87 0.21
88 0.21
89 0.21
90 0.19
91 0.19
92 0.19
93 0.23
94 0.21
95 0.19
96 0.22
97 0.22
98 0.25
99 0.25
100 0.22
101 0.24
102 0.24
103 0.24
104 0.22
105 0.23
106 0.24
107 0.29
108 0.32
109 0.34
110 0.39
111 0.41
112 0.4
113 0.43
114 0.46
115 0.42
116 0.38
117 0.37
118 0.34
119 0.37
120 0.38
121 0.34
122 0.26
123 0.25
124 0.24
125 0.18
126 0.14
127 0.09
128 0.1
129 0.1
130 0.1
131 0.14
132 0.14
133 0.14
134 0.16
135 0.16
136 0.12
137 0.15
138 0.15
139 0.12
140 0.13
141 0.13
142 0.12
143 0.13
144 0.14
145 0.12
146 0.11
147 0.1
148 0.09
149 0.15
150 0.14
151 0.13
152 0.12
153 0.13
154 0.13
155 0.13
156 0.13
157 0.08
158 0.07
159 0.06
160 0.06
161 0.07
162 0.07
163 0.07
164 0.1
165 0.11
166 0.11
167 0.11
168 0.11
169 0.12
170 0.16
171 0.17
172 0.22
173 0.23
174 0.24
175 0.24
176 0.24
177 0.23
178 0.2
179 0.18
180 0.1
181 0.1
182 0.09
183 0.09
184 0.09
185 0.07
186 0.07
187 0.09
188 0.09
189 0.07
190 0.08
191 0.09
192 0.09
193 0.11
194 0.12
195 0.11
196 0.11
197 0.12
198 0.11
199 0.1
200 0.1
201 0.08
202 0.09
203 0.08
204 0.08
205 0.07
206 0.07
207 0.07
208 0.09
209 0.09
210 0.08
211 0.12
212 0.17
213 0.2
214 0.24
215 0.29
216 0.33
217 0.41
218 0.44
219 0.41
220 0.42
221 0.4
222 0.38
223 0.34
224 0.33
225 0.26
226 0.25
227 0.23
228 0.24
229 0.24
230 0.32
231 0.37
232 0.35
233 0.35
234 0.36
235 0.44
236 0.4
237 0.47
238 0.4
239 0.41
240 0.48
241 0.48
242 0.46
243 0.4
244 0.39
245 0.33
246 0.32
247 0.27
248 0.21
249 0.24
250 0.24
251 0.23
252 0.23
253 0.22
254 0.27
255 0.3
256 0.29
257 0.27
258 0.28
259 0.27
260 0.26
261 0.25
262 0.19
263 0.16
264 0.17
265 0.17
266 0.17
267 0.21
268 0.21
269 0.2
270 0.19
271 0.18
272 0.17
273 0.15
274 0.16
275 0.12
276 0.17
277 0.17
278 0.17
279 0.17
280 0.15