Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q8RC13

Protein Details
Accession A0A1Q8RC13    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
76-99ISYPSHVRDYRKKVRKAHTKVASEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17.5, cyto_mito 10.5, cysk 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR008030  NmrA-like  
Pfam View protein in Pfam  
PF05368  NmrA  
Amino Acid Sequences MKSIGIFPGSGALGGSTYDYLLKLLPSDQIILINRHPEKVPQEHIKNGVRARKASYESSPSDLEAVFAGIEVLFLISYPSHVRDYRKKVRKAHTKVASEMNTTRSHHGMKVQLPAIDAARRAGVKHIFYSSLAFAGDLQDSSLAEVMQAHLDSERYLAEAAASDPGFTYTSVREGLYSESFPIYTAFFDLKNPADEILIPHDGSGPGVAWVKRTELGEATAKLISQYSWDPEQFPHVNKKVLLTGPRVWSLEDTVKVLGQVVGKEVRIRKVGVDEYVKLPQVLSRFGSQEKARTWATAWEAISAGETAVVTSTLKEIIGRDPEEFDVTIKCLQTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.06
4 0.07
5 0.08
6 0.08
7 0.08
8 0.09
9 0.09
10 0.09
11 0.1
12 0.12
13 0.13
14 0.14
15 0.14
16 0.19
17 0.21
18 0.24
19 0.25
20 0.32
21 0.31
22 0.32
23 0.32
24 0.33
25 0.37
26 0.4
27 0.46
28 0.47
29 0.51
30 0.54
31 0.61
32 0.61
33 0.61
34 0.6
35 0.59
36 0.54
37 0.51
38 0.51
39 0.5
40 0.49
41 0.47
42 0.46
43 0.45
44 0.43
45 0.45
46 0.4
47 0.33
48 0.31
49 0.26
50 0.21
51 0.14
52 0.12
53 0.07
54 0.06
55 0.06
56 0.04
57 0.04
58 0.04
59 0.04
60 0.03
61 0.03
62 0.04
63 0.04
64 0.05
65 0.07
66 0.1
67 0.13
68 0.17
69 0.24
70 0.33
71 0.43
72 0.53
73 0.61
74 0.67
75 0.72
76 0.8
77 0.85
78 0.84
79 0.84
80 0.82
81 0.77
82 0.72
83 0.71
84 0.63
85 0.55
86 0.49
87 0.42
88 0.37
89 0.34
90 0.33
91 0.28
92 0.27
93 0.25
94 0.27
95 0.29
96 0.28
97 0.32
98 0.31
99 0.29
100 0.28
101 0.27
102 0.24
103 0.2
104 0.17
105 0.12
106 0.12
107 0.12
108 0.11
109 0.15
110 0.17
111 0.17
112 0.18
113 0.19
114 0.18
115 0.18
116 0.19
117 0.15
118 0.12
119 0.11
120 0.09
121 0.08
122 0.08
123 0.08
124 0.06
125 0.06
126 0.05
127 0.05
128 0.05
129 0.06
130 0.04
131 0.04
132 0.04
133 0.04
134 0.05
135 0.05
136 0.05
137 0.04
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.04
146 0.05
147 0.05
148 0.06
149 0.06
150 0.06
151 0.06
152 0.07
153 0.07
154 0.07
155 0.08
156 0.06
157 0.08
158 0.09
159 0.09
160 0.08
161 0.08
162 0.11
163 0.11
164 0.11
165 0.1
166 0.09
167 0.09
168 0.09
169 0.09
170 0.07
171 0.06
172 0.07
173 0.07
174 0.07
175 0.08
176 0.1
177 0.1
178 0.11
179 0.11
180 0.1
181 0.1
182 0.1
183 0.1
184 0.12
185 0.12
186 0.11
187 0.11
188 0.11
189 0.11
190 0.11
191 0.1
192 0.06
193 0.06
194 0.09
195 0.09
196 0.1
197 0.11
198 0.12
199 0.14
200 0.14
201 0.14
202 0.12
203 0.15
204 0.17
205 0.16
206 0.17
207 0.15
208 0.14
209 0.13
210 0.13
211 0.1
212 0.09
213 0.1
214 0.11
215 0.14
216 0.15
217 0.16
218 0.16
219 0.23
220 0.24
221 0.26
222 0.32
223 0.33
224 0.36
225 0.35
226 0.36
227 0.34
228 0.35
229 0.36
230 0.31
231 0.34
232 0.34
233 0.36
234 0.35
235 0.31
236 0.28
237 0.28
238 0.27
239 0.22
240 0.2
241 0.18
242 0.18
243 0.17
244 0.17
245 0.15
246 0.12
247 0.11
248 0.12
249 0.14
250 0.14
251 0.19
252 0.22
253 0.24
254 0.25
255 0.26
256 0.24
257 0.29
258 0.31
259 0.31
260 0.32
261 0.3
262 0.31
263 0.34
264 0.33
265 0.27
266 0.25
267 0.21
268 0.2
269 0.2
270 0.19
271 0.19
272 0.21
273 0.22
274 0.29
275 0.29
276 0.33
277 0.32
278 0.34
279 0.32
280 0.31
281 0.31
282 0.3
283 0.32
284 0.31
285 0.29
286 0.26
287 0.25
288 0.24
289 0.23
290 0.17
291 0.13
292 0.08
293 0.07
294 0.06
295 0.06
296 0.07
297 0.06
298 0.06
299 0.08
300 0.08
301 0.08
302 0.09
303 0.1
304 0.16
305 0.22
306 0.24
307 0.24
308 0.26
309 0.28
310 0.3
311 0.28
312 0.24
313 0.19
314 0.2
315 0.23