Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q8S114

Protein Details
Accession A0A1Q8S114    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-28GVAGRSKGCRACRRRKKGHVLTETRTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto_nucl 3, nucl 2.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MVGVAGRSKGCRACRRRKKGHVLTETRTTNIVSSSAIFNNQIVVTARELMKHASMTDGISL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.77
3 0.84
4 0.88
5 0.91
6 0.9
7 0.91
8 0.89
9 0.85
10 0.79
11 0.76
12 0.67
13 0.57
14 0.47
15 0.37
16 0.27
17 0.21
18 0.16
19 0.08
20 0.08
21 0.09
22 0.09
23 0.09
24 0.09
25 0.09
26 0.1
27 0.09
28 0.1
29 0.1
30 0.11
31 0.11
32 0.14
33 0.14
34 0.14
35 0.15
36 0.16
37 0.16
38 0.16
39 0.15
40 0.14
41 0.15