Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q8RG15

Protein Details
Accession A0A1Q8RG15    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
8-36GHIASNRRAKARKRIRRQKTEKAVLYRKHBasic
NLS Segment(s)
PositionSequence
14-28RRAKARKRIRRQKTE
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences LKRNDFIGHIASNRRAKARKRIRRQKTEKAVLYRKHCNKYTITTTPKEKVVLFKETFFSLPLEVNLKDINNKLYSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.5
4 0.57
5 0.64
6 0.67
7 0.73
8 0.82
9 0.85
10 0.89
11 0.92
12 0.92
13 0.91
14 0.9
15 0.84
16 0.83
17 0.8
18 0.76
19 0.72
20 0.71
21 0.68
22 0.65
23 0.61
24 0.55
25 0.49
26 0.48
27 0.49
28 0.47
29 0.44
30 0.42
31 0.45
32 0.44
33 0.43
34 0.4
35 0.34
36 0.32
37 0.31
38 0.35
39 0.31
40 0.3
41 0.3
42 0.3
43 0.3
44 0.24
45 0.21
46 0.14
47 0.14
48 0.14
49 0.16
50 0.14
51 0.16
52 0.16
53 0.17
54 0.19
55 0.21
56 0.24