Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q8S2K2

Protein Details
Accession A0A1Q8S2K2    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSKFQKRRHRERLRAVDSVHydrophilic
76-105DKYTMFDRKEKKYRKGIHKLPKWTRVSQRLHydrophilic
NLS Segment(s)
PositionSequence
28-31KRRH
84-96KEKKYRKGIHKLP
Subcellular Location(s) mito 22.5, cyto_mito 12.5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRMTSPLSGGLLWKIPWRLSKFQKRRHRERLRAVDSVVATVDAALAKKGETVAALERWKAEMPTEAEMLPRDKYTMFDRKEKKYRKGIHKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.16
5 0.17
6 0.19
7 0.26
8 0.31
9 0.38
10 0.47
11 0.57
12 0.63
13 0.72
14 0.8
15 0.82
16 0.87
17 0.9
18 0.9
19 0.89
20 0.9
21 0.9
22 0.85
23 0.78
24 0.68
25 0.6
26 0.49
27 0.39
28 0.28
29 0.17
30 0.11
31 0.08
32 0.08
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.07
44 0.1
45 0.11
46 0.11
47 0.11
48 0.12
49 0.12
50 0.11
51 0.1
52 0.11
53 0.13
54 0.15
55 0.15
56 0.14
57 0.15
58 0.16
59 0.17
60 0.14
61 0.12
62 0.11
63 0.1
64 0.13
65 0.19
66 0.27
67 0.29
68 0.37
69 0.44
70 0.52
71 0.63
72 0.69
73 0.71
74 0.72
75 0.79
76 0.81
77 0.85
78 0.85
79 0.86
80 0.86
81 0.89
82 0.88
83 0.88
84 0.83
85 0.8
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79