Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q8RVB6

Protein Details
Accession A0A1Q8RVB6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
375-405LEQPLSRNTGKSKNKKKKKPAKKAAAAGEEAHydrophilic
NLS Segment(s)
PositionSequence
384-399GKSKNKKKKKPAKKAA
Subcellular Location(s) cyto 21, cyto_nucl 13.333, mito_nucl 3.666, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036005  Creatinase/aminopeptidase-like  
IPR047113  PA2G4/ARX1  
IPR000994  Pept_M24  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00557  Peptidase_M24  
CDD cd01089  PA2G4-like  
Amino Acid Sequences MSEEIDYTLNNPDTLTKYKTAAQISEKVLAAVTELIVPGEKIVTICEKGDKLIEEELAKVYRGKKVNKGFSHPTTVSPASFVTPYTPLTSDEAEANAEIQAGEPIKIQLGAQIDGFGSIVCDTVIATPKEKAGEEITGRTADLILANYYANEVLLRLLLPPGVLASGTDEEKAKAAAAKPPTQAKITSLLEKVVKAYDCNLVESTTSWLFERNEIEGKKKIVLAPAEGTKGDGTPEIGEVWGVEIGVSLGAGKVKSFDQRTTLHRRTTNTYGLKRPTSRKILSEVQKKFGTFPFSLRQLEDERDAKSGVVECVRGNVFRAYEVVGDKDNSPVARYLTTIAITKNGITKLGAPPALDLNKVKSDKKIEDEEILKILEQPLSRNTGKSKNKKKKKPAKKAAAAGEEAEGSDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.28
4 0.29
5 0.35
6 0.41
7 0.41
8 0.42
9 0.42
10 0.45
11 0.46
12 0.48
13 0.43
14 0.37
15 0.33
16 0.27
17 0.22
18 0.15
19 0.12
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.07
26 0.07
27 0.07
28 0.06
29 0.08
30 0.12
31 0.14
32 0.15
33 0.19
34 0.19
35 0.2
36 0.23
37 0.22
38 0.21
39 0.22
40 0.24
41 0.2
42 0.21
43 0.23
44 0.21
45 0.2
46 0.21
47 0.21
48 0.26
49 0.32
50 0.37
51 0.43
52 0.52
53 0.62
54 0.63
55 0.69
56 0.7
57 0.67
58 0.7
59 0.61
60 0.54
61 0.5
62 0.47
63 0.39
64 0.32
65 0.28
66 0.21
67 0.2
68 0.18
69 0.14
70 0.14
71 0.15
72 0.16
73 0.17
74 0.16
75 0.19
76 0.2
77 0.18
78 0.17
79 0.16
80 0.14
81 0.13
82 0.12
83 0.09
84 0.08
85 0.07
86 0.06
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.09
93 0.09
94 0.09
95 0.1
96 0.11
97 0.12
98 0.11
99 0.11
100 0.11
101 0.11
102 0.11
103 0.07
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.07
111 0.12
112 0.12
113 0.14
114 0.14
115 0.16
116 0.18
117 0.17
118 0.17
119 0.14
120 0.18
121 0.18
122 0.19
123 0.19
124 0.18
125 0.18
126 0.16
127 0.14
128 0.09
129 0.09
130 0.07
131 0.06
132 0.07
133 0.07
134 0.06
135 0.07
136 0.06
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.05
145 0.05
146 0.05
147 0.04
148 0.04
149 0.04
150 0.04
151 0.03
152 0.05
153 0.07
154 0.07
155 0.08
156 0.08
157 0.09
158 0.09
159 0.09
160 0.07
161 0.08
162 0.09
163 0.13
164 0.17
165 0.21
166 0.23
167 0.27
168 0.29
169 0.28
170 0.27
171 0.24
172 0.27
173 0.24
174 0.25
175 0.22
176 0.22
177 0.21
178 0.21
179 0.2
180 0.16
181 0.14
182 0.11
183 0.12
184 0.15
185 0.15
186 0.16
187 0.15
188 0.14
189 0.13
190 0.14
191 0.15
192 0.1
193 0.1
194 0.09
195 0.11
196 0.11
197 0.13
198 0.14
199 0.13
200 0.18
201 0.18
202 0.21
203 0.22
204 0.22
205 0.22
206 0.22
207 0.21
208 0.2
209 0.2
210 0.18
211 0.18
212 0.19
213 0.18
214 0.17
215 0.16
216 0.13
217 0.12
218 0.1
219 0.08
220 0.07
221 0.06
222 0.07
223 0.06
224 0.06
225 0.05
226 0.05
227 0.05
228 0.05
229 0.04
230 0.03
231 0.03
232 0.03
233 0.03
234 0.03
235 0.02
236 0.03
237 0.04
238 0.04
239 0.04
240 0.05
241 0.07
242 0.13
243 0.15
244 0.16
245 0.2
246 0.24
247 0.31
248 0.4
249 0.44
250 0.45
251 0.47
252 0.49
253 0.51
254 0.52
255 0.54
256 0.52
257 0.52
258 0.52
259 0.54
260 0.56
261 0.56
262 0.57
263 0.56
264 0.56
265 0.54
266 0.5
267 0.51
268 0.54
269 0.57
270 0.61
271 0.56
272 0.53
273 0.53
274 0.51
275 0.47
276 0.42
277 0.38
278 0.29
279 0.3
280 0.31
281 0.33
282 0.34
283 0.32
284 0.32
285 0.29
286 0.3
287 0.31
288 0.28
289 0.24
290 0.24
291 0.24
292 0.21
293 0.19
294 0.19
295 0.16
296 0.15
297 0.15
298 0.13
299 0.17
300 0.18
301 0.17
302 0.17
303 0.17
304 0.16
305 0.15
306 0.16
307 0.13
308 0.15
309 0.16
310 0.15
311 0.14
312 0.15
313 0.15
314 0.16
315 0.17
316 0.15
317 0.16
318 0.16
319 0.16
320 0.16
321 0.16
322 0.16
323 0.16
324 0.17
325 0.18
326 0.16
327 0.17
328 0.17
329 0.17
330 0.2
331 0.18
332 0.18
333 0.17
334 0.2
335 0.22
336 0.27
337 0.27
338 0.23
339 0.24
340 0.3
341 0.3
342 0.29
343 0.26
344 0.25
345 0.32
346 0.36
347 0.36
348 0.36
349 0.43
350 0.46
351 0.5
352 0.53
353 0.48
354 0.51
355 0.52
356 0.47
357 0.42
358 0.37
359 0.31
360 0.25
361 0.23
362 0.2
363 0.18
364 0.19
365 0.2
366 0.27
367 0.28
368 0.3
369 0.34
370 0.41
371 0.51
372 0.59
373 0.67
374 0.71
375 0.81
376 0.88
377 0.94
378 0.95
379 0.95
380 0.96
381 0.96
382 0.96
383 0.95
384 0.93
385 0.91
386 0.86
387 0.77
388 0.66
389 0.57
390 0.45
391 0.35