Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VBE2

Protein Details
Accession G0VBE2   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKHSSTTKLIRKRPTVKTFSHKKIKNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
IPR014612  Pop7/Rpp20  
IPR020241  RNase_P/MRP_Pop7_fungi  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0003676  F:nucleic acid binding  
GO:0004526  F:ribonuclease P activity  
GO:0001682  P:tRNA 5'-leader removal  
KEGG ncs:NCAS_0B01840  -  
Pfam View protein in Pfam  
PF12328  Rpp20  
Amino Acid Sequences MKHSSTTKLIRKRPTVKTFSHKKIKNTIYVKSNTPYVSALKRVNKFLERLQKTGGSTHISLLGMGKAIEKTLSIGCHFQTAKGRKVDILTTSVDVIDELEEMEQEEEDILDEDKETVLKKRTISGVEVRIYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.77
4 0.8
5 0.81
6 0.8
7 0.81
8 0.76
9 0.73
10 0.76
11 0.74
12 0.73
13 0.67
14 0.64
15 0.62
16 0.59
17 0.56
18 0.48
19 0.47
20 0.38
21 0.35
22 0.3
23 0.25
24 0.25
25 0.27
26 0.31
27 0.34
28 0.37
29 0.39
30 0.42
31 0.41
32 0.4
33 0.42
34 0.46
35 0.42
36 0.41
37 0.4
38 0.38
39 0.36
40 0.35
41 0.3
42 0.23
43 0.19
44 0.18
45 0.17
46 0.14
47 0.14
48 0.12
49 0.1
50 0.07
51 0.07
52 0.07
53 0.05
54 0.05
55 0.05
56 0.04
57 0.06
58 0.07
59 0.08
60 0.08
61 0.09
62 0.1
63 0.14
64 0.14
65 0.15
66 0.23
67 0.26
68 0.31
69 0.32
70 0.33
71 0.29
72 0.31
73 0.31
74 0.24
75 0.22
76 0.18
77 0.16
78 0.16
79 0.15
80 0.13
81 0.1
82 0.09
83 0.06
84 0.05
85 0.04
86 0.04
87 0.04
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.04
94 0.05
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.07
101 0.08
102 0.09
103 0.14
104 0.19
105 0.23
106 0.24
107 0.29
108 0.34
109 0.36
110 0.4
111 0.42
112 0.44