Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q8RVM6

Protein Details
Accession A0A1Q8RVM6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-31VHAGVTQQRKREKKRRRKKDYILRWTRPMRBasic
NLS Segment(s)
PositionSequence
10-20RKREKKRRRKK
Subcellular Location(s) mito 13, nucl 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MVHAGVTQQRKREKKRRRKKDYILRWTRPMRLVMVGGRQASGRNQQRSDSHRLPSYPPSSVLVRLVHVTPVGVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.87
3 0.91
4 0.92
5 0.94
6 0.94
7 0.95
8 0.95
9 0.94
10 0.94
11 0.88
12 0.86
13 0.79
14 0.72
15 0.64
16 0.54
17 0.44
18 0.35
19 0.31
20 0.24
21 0.23
22 0.2
23 0.17
24 0.16
25 0.15
26 0.14
27 0.14
28 0.21
29 0.25
30 0.28
31 0.29
32 0.32
33 0.38
34 0.43
35 0.5
36 0.46
37 0.43
38 0.41
39 0.42
40 0.43
41 0.45
42 0.43
43 0.35
44 0.33
45 0.32
46 0.3
47 0.3
48 0.31
49 0.24
50 0.22
51 0.22
52 0.21
53 0.19
54 0.17
55 0.15