Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q8RZF2

Protein Details
Accession A0A1Q8RZF2    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-44SPSAPSRQLSRPSKKVRSNELVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013868  Cut8/Sts1_fam  
IPR038422  Cut8/Sts1_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0000502  C:proteasome complex  
GO:0071630  P:nuclear protein quality control by the ubiquitin-proteasome system  
GO:0031144  P:proteasome localization  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF08559  Cut8  
Amino Acid Sequences MATSRKRKADEDGDEMSLSPRSSPSAPSRQLSRPSKKVRSNELVGRPLTLPRLLETLDPTQLRTVLERICERHPDIGREVVSSAPRPTVEAAHGVLQEYQEKMKASIPYGETSPDYTYYRVKAPLTALIDALLDFTPQYLPPNESQTTVSLQYLDGATKIIHALPDWEPQQYRHHKENAYDEISKAWALVINEAAKRGGGLSLHTGGWDQTLAKHHEMSGGRMGTAMNSMAAGVSWMANNNSNGQPGNSSSDPNSILNQLMSGTYGAPVRVGPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.44
3 0.37
4 0.29
5 0.22
6 0.16
7 0.13
8 0.15
9 0.16
10 0.21
11 0.28
12 0.36
13 0.41
14 0.44
15 0.49
16 0.53
17 0.62
18 0.66
19 0.67
20 0.67
21 0.73
22 0.79
23 0.81
24 0.82
25 0.82
26 0.79
27 0.77
28 0.76
29 0.73
30 0.69
31 0.61
32 0.55
33 0.47
34 0.41
35 0.36
36 0.29
37 0.22
38 0.17
39 0.19
40 0.17
41 0.17
42 0.19
43 0.2
44 0.23
45 0.23
46 0.22
47 0.21
48 0.22
49 0.21
50 0.19
51 0.2
52 0.16
53 0.21
54 0.23
55 0.26
56 0.28
57 0.32
58 0.32
59 0.36
60 0.37
61 0.36
62 0.35
63 0.36
64 0.33
65 0.29
66 0.28
67 0.23
68 0.22
69 0.2
70 0.18
71 0.15
72 0.14
73 0.15
74 0.15
75 0.14
76 0.13
77 0.13
78 0.13
79 0.14
80 0.14
81 0.14
82 0.13
83 0.13
84 0.13
85 0.12
86 0.11
87 0.11
88 0.11
89 0.12
90 0.15
91 0.16
92 0.16
93 0.19
94 0.2
95 0.19
96 0.19
97 0.2
98 0.16
99 0.16
100 0.16
101 0.14
102 0.14
103 0.14
104 0.16
105 0.16
106 0.17
107 0.18
108 0.18
109 0.17
110 0.17
111 0.2
112 0.2
113 0.19
114 0.16
115 0.14
116 0.14
117 0.12
118 0.12
119 0.07
120 0.05
121 0.04
122 0.04
123 0.04
124 0.05
125 0.06
126 0.06
127 0.08
128 0.1
129 0.15
130 0.15
131 0.16
132 0.17
133 0.17
134 0.18
135 0.17
136 0.16
137 0.11
138 0.11
139 0.1
140 0.1
141 0.08
142 0.06
143 0.06
144 0.06
145 0.05
146 0.06
147 0.05
148 0.05
149 0.05
150 0.08
151 0.09
152 0.14
153 0.14
154 0.16
155 0.17
156 0.19
157 0.28
158 0.34
159 0.38
160 0.39
161 0.44
162 0.45
163 0.48
164 0.53
165 0.5
166 0.46
167 0.41
168 0.36
169 0.31
170 0.29
171 0.25
172 0.18
173 0.11
174 0.09
175 0.08
176 0.09
177 0.11
178 0.13
179 0.13
180 0.14
181 0.14
182 0.11
183 0.11
184 0.1
185 0.09
186 0.06
187 0.07
188 0.1
189 0.12
190 0.12
191 0.12
192 0.12
193 0.11
194 0.11
195 0.1
196 0.08
197 0.09
198 0.15
199 0.19
200 0.2
201 0.21
202 0.2
203 0.26
204 0.27
205 0.27
206 0.28
207 0.25
208 0.23
209 0.23
210 0.22
211 0.16
212 0.16
213 0.13
214 0.07
215 0.06
216 0.06
217 0.05
218 0.05
219 0.05
220 0.04
221 0.05
222 0.05
223 0.07
224 0.09
225 0.12
226 0.14
227 0.18
228 0.19
229 0.21
230 0.21
231 0.2
232 0.21
233 0.2
234 0.26
235 0.23
236 0.24
237 0.23
238 0.27
239 0.29
240 0.28
241 0.28
242 0.23
243 0.23
244 0.2
245 0.19
246 0.15
247 0.12
248 0.12
249 0.1
250 0.09
251 0.09
252 0.11
253 0.1
254 0.1