Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q8RYC4

Protein Details
Accession A0A1Q8RYC4    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-69YIHFATLKPEQKKKKEPKKSGGKKBasic
NLS Segment(s)
PositionSequence
55-69EQKKKKEPKKSGGKK
Subcellular Location(s) cyto 5.5, plas 5, extr 5, E.R. 5, cyto_nucl 4.5, mito 3, nucl 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGQFDWFRSIGATPEAVAVLNDQPILFTILLVVLVGVILQILLIWYIHFATLKPEQKKKKEPKKSGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.09
5 0.09
6 0.08
7 0.08
8 0.08
9 0.07
10 0.07
11 0.07
12 0.09
13 0.08
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.02
21 0.02
22 0.02
23 0.02
24 0.01
25 0.01
26 0.01
27 0.01
28 0.02
29 0.02
30 0.02
31 0.02
32 0.03
33 0.03
34 0.04
35 0.05
36 0.05
37 0.1
38 0.18
39 0.27
40 0.34
41 0.43
42 0.52
43 0.61
44 0.72
45 0.79
46 0.82
47 0.85
48 0.88
49 0.9