FuNGI

A0A1Q8RV38

Protein Details

Accession

A0A1Q8RV38

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
417-443	FGPCCNSGRCTNKKSQCKVKCGCEQEF	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

extr 19, mito 5, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR005103 AA9
Gene Ontology	GO:0005576 C:extracellular region
Pfam	View protein in Pfam PF03443 AA9
CDD	cd21175 LPMO_AA9

Amino Acid Sequences

IPKTFVCLSPKMKFLTLALALASAANAHTLLSELYINGKSQGDATCLRMPKEGDTSTSPVAGLTSDDMACGKDGEIAAAYTCAAPGSSKLTFEFREWPDARAEGSIDSSHKGPCAVYVKKVDDMAKTSAAGPGWFKIWDEGYDESTKQWCVDKLIANKGLLTVELPSGLPAGYYLIRTEILALHQAVSLKDPQYYVGCAQVYVQDGPSGSLEIPAKNSVSIPGYIDGSEPGNNFNLYDNPKFPYPIPGPEVYSPVGSSTGASAKSVSTFEGGVPDDCLIKNANWCGKPLEKYSSETGCWAAVDACYAQGDKCFNSAPPTGAKNCYVWNDNMCKAVESQCRAKNFNGPPTPNLEEKDTPLPGPIPGAPSTSAPAPAATSSAAAVPAPAPSSPAQGGLKVSTDGTCGGETGLTCEGSSFGPCCNSGRCTNKKSQCKVKCGCEQEFGLCLKGRNTLSRKH

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.38
2	0.38
3	0.32
4	0.28
5	0.23
6	0.2
7	0.18
8	0.16
9	0.15
10	0.07
11	0.06
12	0.06
13	0.05
14	0.05
15	0.05
16	0.06
17	0.06
18	0.07
19	0.07
20	0.07
21	0.11
22	0.12
23	0.13
24	0.15
25	0.15
26	0.14
27	0.17
28	0.18
29	0.18
30	0.19
31	0.24
32	0.29
33	0.31
34	0.32
35	0.34
36	0.33
37	0.33
38	0.39
39	0.34
40	0.32
41	0.33
42	0.37
43	0.34
44	0.33
45	0.28
46	0.21
47	0.2
48	0.16
49	0.12
50	0.09
51	0.1
52	0.09
53	0.1
54	0.1
55	0.1
56	0.11
57	0.1
58	0.09
59	0.09
60	0.09
61	0.1
62	0.1
63	0.1
64	0.1
65	0.09
66	0.09
67	0.06
68	0.07
69	0.06
70	0.05
71	0.05
72	0.06
73	0.12
74	0.12
75	0.13
76	0.15
77	0.19
78	0.21
79	0.23
80	0.3
81	0.27
82	0.36
83	0.36
84	0.36
85	0.34
86	0.34
87	0.32
88	0.24
89	0.23
90	0.14
91	0.15
92	0.15
93	0.13
94	0.14
95	0.15
96	0.14
97	0.14
98	0.14
99	0.12
100	0.16
101	0.22
102	0.23
103	0.27
104	0.33
105	0.35
106	0.36
107	0.4
108	0.36
109	0.31
110	0.33
111	0.31
112	0.26
113	0.24
114	0.22
115	0.21
116	0.18
117	0.17
118	0.14
119	0.12
120	0.12
121	0.11
122	0.11
123	0.11
124	0.12
125	0.12
126	0.14
127	0.14
128	0.17
129	0.18
130	0.18
131	0.18
132	0.19
133	0.18
134	0.16
135	0.17
136	0.15
137	0.16
138	0.2
139	0.25
140	0.29
141	0.36
142	0.38
143	0.35
144	0.34
145	0.31
146	0.27
147	0.21
148	0.16
149	0.09
150	0.06
151	0.07
152	0.07
153	0.06
154	0.06
155	0.06
156	0.05
157	0.04
158	0.06
159	0.06
160	0.06
161	0.06
162	0.07
163	0.07
164	0.08
165	0.08
166	0.07
167	0.07
168	0.09
169	0.09
170	0.08
171	0.09
172	0.1
173	0.1
174	0.11
175	0.12
176	0.11
177	0.12
178	0.11
179	0.12
180	0.12
181	0.13
182	0.12
183	0.13
184	0.13
185	0.12
186	0.12
187	0.13
188	0.13
189	0.12
190	0.12
191	0.09
192	0.09
193	0.1
194	0.1
195	0.08
196	0.06
197	0.09
198	0.09
199	0.09
200	0.1
201	0.11
202	0.11
203	0.1
204	0.1
205	0.09
206	0.09
207	0.09
208	0.09
209	0.09
210	0.09
211	0.09
212	0.09
213	0.08
214	0.08
215	0.09
216	0.08
217	0.08
218	0.08
219	0.08
220	0.08
221	0.08
222	0.12
223	0.14
224	0.16
225	0.16
226	0.17
227	0.18
228	0.19
229	0.18
230	0.22
231	0.2
232	0.22
233	0.24
234	0.24
235	0.25
236	0.25
237	0.27
238	0.2
239	0.18
240	0.15
241	0.12
242	0.11
243	0.09
244	0.08
245	0.07
246	0.08
247	0.08
248	0.08
249	0.08
250	0.08
251	0.09
252	0.09
253	0.09
254	0.07
255	0.07
256	0.07
257	0.09
258	0.1
259	0.09
260	0.09
261	0.09
262	0.09
263	0.09
264	0.1
265	0.09
266	0.09
267	0.11
268	0.15
269	0.2
270	0.2
271	0.21
272	0.24
273	0.27
274	0.3
275	0.3
276	0.32
277	0.29
278	0.32
279	0.35
280	0.34
281	0.3
282	0.28
283	0.25
284	0.19
285	0.17
286	0.14
287	0.1
288	0.07
289	0.08
290	0.07
291	0.06
292	0.06
293	0.07
294	0.07
295	0.08
296	0.1
297	0.1
298	0.11
299	0.12
300	0.12
301	0.17
302	0.18
303	0.17
304	0.2
305	0.23
306	0.25
307	0.27
308	0.28
309	0.24
310	0.26
311	0.28
312	0.27
313	0.25
314	0.28
315	0.3
316	0.3
317	0.32
318	0.29
319	0.27
320	0.25
321	0.31
322	0.31
323	0.3
324	0.37
325	0.38
326	0.42
327	0.44
328	0.44
329	0.46
330	0.46
331	0.51
332	0.52
333	0.5
334	0.47
335	0.51
336	0.53
337	0.47
338	0.43
339	0.39
340	0.32
341	0.33
342	0.37
343	0.31
344	0.28
345	0.26
346	0.25
347	0.2
348	0.21
349	0.18
350	0.16
351	0.15
352	0.17
353	0.17
354	0.17
355	0.19
356	0.17
357	0.17
358	0.14
359	0.14
360	0.13
361	0.12
362	0.12
363	0.1
364	0.1
365	0.09
366	0.09
367	0.09
368	0.07
369	0.08
370	0.07
371	0.08
372	0.08
373	0.08
374	0.1
375	0.11
376	0.15
377	0.15
378	0.19
379	0.19
380	0.2
381	0.22
382	0.2
383	0.21
384	0.18
385	0.18
386	0.14
387	0.14
388	0.14
389	0.14
390	0.13
391	0.11
392	0.11
393	0.11
394	0.1
395	0.12
396	0.13
397	0.11
398	0.11
399	0.11
400	0.12
401	0.12
402	0.14
403	0.12
404	0.11
405	0.14
406	0.15
407	0.18
408	0.21
409	0.25
410	0.31
411	0.4
412	0.48
413	0.53
414	0.63
415	0.7
416	0.76
417	0.81
418	0.84
419	0.83
420	0.85
421	0.86
422	0.84
423	0.84
424	0.82
425	0.77
426	0.72
427	0.65
428	0.58
429	0.54
430	0.46
431	0.41
432	0.35
433	0.32
434	0.28
435	0.32
436	0.32
437	0.37

A0A1Q8RV38

3D AlphaFold-predicted Structure Viewer