Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q8RWE2

Protein Details
Accession A0A1Q8RWE2    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
199-223VELERNPDSRRSRRARRTAEEEVSFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_mito 11.5, mito 6.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013830  SGNH_hydro  
IPR036514  SGNH_hydro_sf  
Pfam View protein in Pfam  
PF13472  Lipase_GDSL_2  
CDD cd00229  SGNH_hydrolase  
Amino Acid Sequences MPKDHTLRIFCFGDSLTAGYSSYGAVYRPYSVALVERLSRDLRSTQVVAVDNGMPGDVVSQGAFAQRFESEVGQTKYDWAIILGGTNDLAYNVPPQRIFDSLRRVYDSALARGIKVLALTVPECSAKNADLDARRRELNAAILSHKAQNYHAFDLNPRIPYHALTDRERARYWDDGLHLTPAGYDWMGTHVADALGDLVELERNPDSRRSRRARRTAEEEVSFEEESGDPSALSEGYVVVRMRDLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.13
4 0.12
5 0.12
6 0.11
7 0.11
8 0.08
9 0.08
10 0.08
11 0.08
12 0.09
13 0.11
14 0.12
15 0.12
16 0.13
17 0.13
18 0.13
19 0.15
20 0.15
21 0.16
22 0.17
23 0.18
24 0.2
25 0.21
26 0.21
27 0.21
28 0.21
29 0.21
30 0.23
31 0.23
32 0.21
33 0.24
34 0.25
35 0.22
36 0.22
37 0.2
38 0.16
39 0.14
40 0.13
41 0.08
42 0.06
43 0.07
44 0.05
45 0.04
46 0.04
47 0.05
48 0.05
49 0.08
50 0.08
51 0.08
52 0.09
53 0.08
54 0.09
55 0.1
56 0.11
57 0.11
58 0.18
59 0.2
60 0.19
61 0.19
62 0.2
63 0.19
64 0.18
65 0.16
66 0.09
67 0.08
68 0.07
69 0.07
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.04
78 0.09
79 0.1
80 0.11
81 0.12
82 0.13
83 0.15
84 0.17
85 0.2
86 0.2
87 0.28
88 0.3
89 0.31
90 0.33
91 0.31
92 0.29
93 0.32
94 0.29
95 0.21
96 0.22
97 0.2
98 0.17
99 0.17
100 0.17
101 0.11
102 0.09
103 0.08
104 0.04
105 0.05
106 0.05
107 0.05
108 0.06
109 0.07
110 0.07
111 0.08
112 0.08
113 0.08
114 0.08
115 0.08
116 0.11
117 0.15
118 0.2
119 0.22
120 0.23
121 0.23
122 0.23
123 0.24
124 0.21
125 0.2
126 0.18
127 0.16
128 0.15
129 0.16
130 0.17
131 0.18
132 0.18
133 0.15
134 0.14
135 0.19
136 0.22
137 0.24
138 0.25
139 0.23
140 0.24
141 0.29
142 0.31
143 0.27
144 0.23
145 0.22
146 0.2
147 0.21
148 0.25
149 0.25
150 0.27
151 0.28
152 0.35
153 0.37
154 0.4
155 0.4
156 0.37
157 0.34
158 0.33
159 0.32
160 0.28
161 0.25
162 0.24
163 0.25
164 0.24
165 0.2
166 0.17
167 0.14
168 0.11
169 0.1
170 0.07
171 0.06
172 0.05
173 0.07
174 0.09
175 0.08
176 0.08
177 0.08
178 0.08
179 0.07
180 0.07
181 0.05
182 0.04
183 0.04
184 0.04
185 0.04
186 0.05
187 0.05
188 0.07
189 0.08
190 0.1
191 0.13
192 0.21
193 0.29
194 0.36
195 0.47
196 0.55
197 0.64
198 0.73
199 0.82
200 0.84
201 0.84
202 0.85
203 0.84
204 0.81
205 0.73
206 0.65
207 0.58
208 0.52
209 0.43
210 0.35
211 0.27
212 0.19
213 0.18
214 0.18
215 0.14
216 0.1
217 0.1
218 0.11
219 0.09
220 0.09
221 0.08
222 0.07
223 0.07
224 0.12
225 0.12
226 0.11