Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Q8RVL0

Protein Details
Accession A0A1Q8RVL0   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-48KERNPITRKRISHRKSRTGCBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.5, cyto 9, nucl 8, mito 5, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
CDD cd00067  GAL4  
Amino Acid Sequences MITDATGLVILDDSGYSTTPAPEVVSEPKERNPITRKRISHRKSRTGCQACKDSKVKARSFLICDELRPSCLRCDRLQILCEYRRSRNHLSPDDSHTSPNAAVKREPTSSASPVIETRLNLLQLELLQTYATFTCTTMPWLPALKDFWRVTVPNLALNNDYLMSALLAIPALHLAHVRPERRGFYVSAALEYHQTASEAARVKLQNVSEHAGAPLLLFSALSVITGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.09
6 0.09
7 0.1
8 0.09
9 0.1
10 0.12
11 0.17
12 0.22
13 0.26
14 0.28
15 0.32
16 0.39
17 0.39
18 0.45
19 0.47
20 0.53
21 0.58
22 0.64
23 0.66
24 0.68
25 0.79
26 0.76
27 0.78
28 0.78
29 0.8
30 0.77
31 0.79
32 0.8
33 0.79
34 0.78
35 0.74
36 0.73
37 0.65
38 0.67
39 0.62
40 0.58
41 0.56
42 0.6
43 0.56
44 0.53
45 0.55
46 0.51
47 0.51
48 0.47
49 0.44
50 0.36
51 0.34
52 0.32
53 0.27
54 0.24
55 0.23
56 0.22
57 0.22
58 0.27
59 0.29
60 0.26
61 0.33
62 0.36
63 0.39
64 0.39
65 0.37
66 0.38
67 0.39
68 0.44
69 0.4
70 0.41
71 0.43
72 0.48
73 0.51
74 0.51
75 0.55
76 0.55
77 0.56
78 0.54
79 0.54
80 0.52
81 0.46
82 0.4
83 0.32
84 0.27
85 0.22
86 0.23
87 0.19
88 0.15
89 0.15
90 0.17
91 0.2
92 0.2
93 0.21
94 0.2
95 0.21
96 0.21
97 0.23
98 0.2
99 0.18
100 0.17
101 0.18
102 0.15
103 0.12
104 0.12
105 0.11
106 0.12
107 0.11
108 0.1
109 0.09
110 0.08
111 0.09
112 0.07
113 0.05
114 0.05
115 0.05
116 0.06
117 0.05
118 0.07
119 0.06
120 0.06
121 0.07
122 0.07
123 0.11
124 0.11
125 0.12
126 0.12
127 0.14
128 0.14
129 0.15
130 0.18
131 0.16
132 0.22
133 0.22
134 0.22
135 0.24
136 0.24
137 0.24
138 0.27
139 0.26
140 0.23
141 0.24
142 0.24
143 0.21
144 0.21
145 0.19
146 0.13
147 0.12
148 0.08
149 0.07
150 0.06
151 0.05
152 0.05
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.05
161 0.05
162 0.13
163 0.19
164 0.21
165 0.25
166 0.3
167 0.32
168 0.35
169 0.37
170 0.31
171 0.29
172 0.34
173 0.3
174 0.28
175 0.25
176 0.23
177 0.22
178 0.21
179 0.18
180 0.11
181 0.11
182 0.1
183 0.1
184 0.15
185 0.17
186 0.17
187 0.22
188 0.23
189 0.24
190 0.28
191 0.29
192 0.29
193 0.29
194 0.33
195 0.28
196 0.28
197 0.27
198 0.22
199 0.2
200 0.15
201 0.11
202 0.07
203 0.06
204 0.05
205 0.05
206 0.05
207 0.05