Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q8RBR1

Protein Details
Accession A0A1Q8RBR1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-27SSQHNQSRKAHRNGIKKPKTSHydrophilic
NLS Segment(s)
PositionSequence
14-62RKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSRKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKRETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.79
4 0.77
5 0.79
6 0.8
7 0.83
8 0.81
9 0.78
10 0.78
11 0.78
12 0.79
13 0.76
14 0.75
15 0.73
16 0.7
17 0.67
18 0.64
19 0.6
20 0.57
21 0.54
22 0.55
23 0.5
24 0.53
25 0.56
26 0.61
27 0.65
28 0.66
29 0.72
30 0.66
31 0.71
32 0.65
33 0.66
34 0.64
35 0.57
36 0.54
37 0.48
38 0.45
39 0.39
40 0.39
41 0.31
42 0.31
43 0.36
44 0.4
45 0.45