Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Q8RX84

Protein Details
Accession A0A1Q8RX84    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-32DYEHSSAKRKGQKKRTSPRETIEHydrophilic
NLS Segment(s)
PositionSequence
17-27KRKGQKKRTSP
Subcellular Location(s) nucl 14, cyto 8, mito 4
Family & Domain DBs
Amino Acid Sequences MKPYGQGAIDYEHSSAKRKGQKKRTSPRETIEKELRSKQGNNTRLSENVPPFITPPWWRGPRIFIVDTAEAATKEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.29
4 0.36
5 0.43
6 0.52
7 0.6
8 0.69
9 0.75
10 0.84
11 0.87
12 0.86
13 0.84
14 0.8
15 0.8
16 0.73
17 0.7
18 0.66
19 0.6
20 0.55
21 0.54
22 0.51
23 0.44
24 0.42
25 0.42
26 0.44
27 0.45
28 0.45
29 0.43
30 0.41
31 0.39
32 0.4
33 0.38
34 0.3
35 0.27
36 0.24
37 0.21
38 0.21
39 0.21
40 0.22
41 0.18
42 0.21
43 0.27
44 0.31
45 0.32
46 0.33
47 0.37
48 0.4
49 0.44
50 0.41
51 0.34
52 0.35
53 0.34
54 0.33
55 0.3
56 0.24